ACTN2 (NM_001103) Human Tagged ORF Clone

CAT#: RG208531

ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ACTN2 (NM_001103) Human Tagged ORF Clone
Symbol ACTN2
Synonyms CMD1AA
Vector pCMV6-AC-GFP
Sequence Data
>RG208531 representing NM_001103
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCAGATAGAGCCCGGCGTGCAGTACAACTACGTGTACGACGAGGATGAGTACATGATCCAGGAGG
AGGAGTGGGACCGCGACCTGCTCCTGGACCCAGCCTGGGAGAAGCAGCAGAGGAAGACCTTCACTGCCTG
GTGTAACTCCCACCTAAGGAAAGCCGGCACCCAGATTGAGAACATCGAGGAAGACTTCAGGAATGGCCTT
AAGCTCATGCTGCTTTTGGAAGTCATCTCAGGGGAAAGGCTGCCCAAACCTGACCGGGGAAAAATGCGGT
TCCACAAAATTGCTAATGTCAACAAAGCTTTGGATTACATAGCCAGCAAAGGGGTGAAACTGGTGTCCAT
CGGCGCTGAAGAAATTGTTGATGGCAATGTGAAAATGACCCTGGGTATGATCTGGACCATCATCCTTCGC
TTTGCTATTCAGGATATTTCGGTTGAAGAAACATCTGCCAAAGAAGGTCTGCTGCTTTGGTGTCAGAGGA
AAACTGCTCCTTATAGAAATGTGAACATTCAGAACTTCCATACTAGCTGGAAAGATGGCCTTGGACTCTG
TGCCCTCATCCACCGACACCGGCCTGACCTCATTGACTACTCAAAGCTTAACAAGGATGACCCCATAGGA
AATATTAACCTGGCCATGGAAATCGCTGAGAAGCACCTGGATATTCCTAAAATGTTGGATGCTGAAGACA
TCGTGAACACCCCTAAACCCGATGAAAGAGCCATCATGACGTACGTCTCTTGCTTCTACCACGCTTTTGC
GGGCGCGGAGCAGGCCGAGACAGCGGCTAACAGGATATGTAAGGTTCTTGCTGTGAATCAAGAGAATGAG
AGGCTGATGGAAGAATATGAGAGGCTAGCGAGTGAGCTTTTGGAATGGATTCGTCGCACGATCCCCTGGC
TGGAGAACCGGACTCCCGAGAAGACCATGCAAGCCATGCAGAAGAAGCTGGAGGACTTCCGGGATTACCG
CCGGAAGCACAAGCCACCCAAGGTGCAGGAGAAATGCCAGCTGGAGATCAACTTCAACACGCTGCAGACC
AAGCTGCGGATCAGCAACCGTCCTGCCTTCATGCCCTCCGAGGGCAAGATGGTGTCGGATATTGCTGGTG
CCTGGCAGAGGCTGGAGCAGGCTGAGAAGGGTTACGAGGAGTGGTTGCTCAATGAGATTCGGAGACTGGA
GCGCTTGGAACACCTGGCTGAGAAGTTCAGGCAGAAGGCCTCAACGCACGAGACTTGGGCTTATGGCAAA
GAGCAGATCTTGCTGCAGAAGGATTACGAGTCGGCGTCGCTGACAGAGGTGCGGGCTCTGCTGCGGAAGC
ACGAGGCGTTCGAGAGCGACCTGGCAGCGCACCAGGACCGCGTGGAGCAGATCGCAGCCATCGCGCAGGA
GCTCAATGAACTGGACTATCACGACGCTGTGAATGTCAATGATCGGTGCCAGAAAATTTGTGACCAGTGG
GACCGACTGGGAACGCTTACTCAGAAGAGGAGAGAAGCCCTAGAGAGAATGGAGAAATTGCTAGAAACCA
TTGATCAGCTTCACCTGGAGTTTGCCAAGAGGGCTGCTCCTTTCAACAATTGGATGGAGGGCGCTATGGA
GGATCTGCAAGATATGTTCATTGTCCACAGCATTGAGGAGATCCAGAGTCTGATCACTGCGCATGAGCAG
TTCAAGGCCACGCTGCCCGAGGCGGACGGAGAGCGGCAGTCCATCATGGCCATCCAGAACGAGGTGGAGA
AGGTGATTCAGAGCTACAACATCAGAATCAGCTCAAGCAACCCGTACAGCACTGTCACCATGGATGAGCT
CCGGACCAAGTGGGACAAGGTGAAGCAACTCGTGCCCATCCGCGATCAATCCCTGCAGGAGGAGCTGGCT
CGCCAGCATGCTAACGAGCGTCTGAGGCGCCAGTTTGCTGCCCAAGCCAATGCCATTGGGCCCTGGATCC
AGAACAAGATGGAGGAGATTGCCCGGAGCTCCATCCAGATCACAGGAGCCCTGGAAGACCAGATGAACCA
GCTGAAGCAGTATGAGCACAACATCATCAACTATAAGAACAACATCGACAAGCTGGAGGGAGACCATCAG
CTCATCCAGGAGGCCCTTGTCTTTGACAACAAGCACACGAACTACACGATGGAGCACATTCGTGTTGGAT
GGGAGCTGCTGCTGACAACCATCGCCAGAACCATCAATGAGGTGGAGACTCAGATCCTGACGAGAGATGC
GAAGGGCATCACCCAGGAGCAGATGAATGAGTTCAGAGCCTCCTTCAACCACTTTGACAGGAGGAAGAAT
GGCCTGATGGATCATGAGGATTTCAGAGCCTGCCTGATTTCCATGGGTTATGACCTGGGTGAAGCCGAAT
TTGCCCGCATTATGACCCTGGTAGATCCCAACGGGCAAGGCACCGTCACCTTCCAATCCTTCATCGACTT
CATGACTAGAGAGACGGCTGACACCGACACTGCCGAGCAGGTCATCGCCTCCTTCCGGATCCTGGCTTCT
GATAAGCCATACATCCTGGCGGAGGAGCTGCGTCGGGAGCTGCCCCCGGATCAGGCCCAGTACTGCATCA
AGAGGATGCCCGCCTACTCGGGCCCAGGCAGTGTGCCTGGTGCACTGGATTACGCTGCGTTCTCTTCCGC
ACTCTACGGGGAGAGCGATCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG208531 representing NM_001103
Red=Cloning site Green=Tags(s)

MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGL
KLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILR
FAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIG
NINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENE
RLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQT
KLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQW
DRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQ
FKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELA
RQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQ
LIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKN
GLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001103
ORF Size 2682 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001103.1, NP_001094
RefSeq Size 4181
RefSeq ORF 2685
Locus ID 88
Cytogenetics 1q43
Domains CH, SPEC, EFh
Protein Pathways Focal adhesion, Adherens junction, Tight junction, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Systemic lupus erythematosus, Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Gene Summary F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)