C6orf134(ATAT1) (NM_001031722) Human Tagged ORF Clone

CAT#: RG208373

  • TrueORF®

ATAT1 (GFP-tagged) - Human alpha tubulin acetyltransferase 1 (ATAT1), transcript variant 1

 Cited in 1 publication.

  View "NM_001031722" in other vectors (10)

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name C6orf134(ATAT1) (NM_001031722) Human Tagged ORF Clone
Symbol ATAT1
Synonyms alpha-TAT; alpha-TAT1; C6orf134; MEC17; Nbla00487; TAT
Vector pCMV6-AC-GFP
Sequence Data
>RG208373 representing NM_001031722
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGTTGACCTGGCCTTTCTGCTTCCTCACAATAACCTTAAGGGAGGAGGGAGTGTGCCACCTTGAAA
GTGTTGATCTACAGCAGCAAATTATGACCATTATAGATGAACTGGGCAAGGCTTCTGCCAAGGCCCAGAA
TCTTTCCGCTCCTATCACTAGTGCATCAAGGATGCAGAGTAACCGCCATGTTGTTTATATTCTCAAAGAC
AGTTCAGCCCGACCGGCTGGAAAAGGAGCCATTATTGGTTTCATCAAAGTTGGATACAAGAAGCTCTTTG
TACTGGATGATCGTGAGGCTCATAATGAGGTAGAACCACTTTGCATCCTGGACTTTTACATCCATGAGTC
TGTGCAACGCCATGGCCATGGGCGAGAACTCTTCCAGTATATGTTGCAGAAGGAGCGAGTGGAACCGCAC
CAACTGGCAATTGACCGACCCTCACAGAAGCTGCTGAAATTCCTGAATAAGCACTACAATCTGGAGACCA
CAGTCCCACAGGTGAACAACTTTGTGATCTTTGAAGGCTTCTTTGCCCATCAACATCGGCCCCCTGCTCC
CTCTCTGAGGGCAACTCGACACTCTCGTGCTGCTGCAGTCGATCCCACGCCCGCTGCTCCAGCAAGGAAG
CTGCCACCCAAGAGAGCAGAGGGAGACATCAAGCCATACTCCTCTAGTGACCGAGAATTTCTGAAGGTAG
CTGTGGAGCCTCCTTGGCCCCTAAACAGGGCCCCTCGCCGCGCCACACCTCCAGCCCACCCACCCCCCCG
CTCCAGCAGCCTGGGAAACTCACCAGAACGAGGTCCCCTCCGCCCCTTTGTGCCAGAGCAGGAGCTGCTG
CGTTCCTTGCGCCTCTGCCCCCCACACCCTACCGCCCGCCTTCTGTTGGCTGCTGACCCTGGGGGCAGCC
CAGCTCAACGTCGTCGCACCAGGGGGACTCCCCCAGGTCTGGTAGCCCAAAGCTGCTGCTACAGCCGCCA
TGGGGGGGTGAATTCCTCATCCCCCAATACAGGCAACCAAGACTCCAAGCAGGGAGAACAGGAAACAAAG
AATAGGTCTGCCAGTGAGGAGCAGGCCTTGTCACAGGATGGGTCTGGGGAGAAGCCCATGCACACAGCTC
CTCCACAGGCCCCGGCCCCGCCAGCCCAGTCCTGGACAGTGGGTGGGGACATACTCAACGCCAGGTTCAT
TCGAAACCTGCAGGAACGTCGCAGCACCAGGCCTTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG208373 representing NM_001031722
Red=Cloning site Green=Tags(s)

MWLTWPFCFLTITLREEGVCHLESVDLQQQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKD
SSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPH
QLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFEGFFAHQHRPPAPSLRATRHSRAAAVDPTPAAPARK
LPPKRAEGDIKPYSSSDREFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERGPLRPFVPEQELL
RSLRLCPPHPTARLLLAADPGGSPAQRRRTRGTPPGLVAQSCCYSRHGGVNSSSPNTGNQDSKQGEQETK
NRSASEEQALSQDGSGEKPMHTAPPQAPAPPAQSWTVGGDILNARFIRNLQERRSTRPW

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001031722
ORF Size 1227 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001031722.1, NP_001026892
RefSeq Size 1740
RefSeq ORF 1230
Locus ID 79969
Cytogenetics 6p21.33
Gene Summary This gene encodes a protein that localizes to clathrin-coated pits, where it acetylates alpha tubulin on lysine 40. This process may be important in microtubule growth, for instance during chemotaxis and the formation of cilium. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].

Citations (1)

Other Versions

Other products for "ATAT1"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies