GPR37 (NM_005302) Human Tagged ORF Clone

CAT#: RG208054

GPR37 (GFP-tagged) - Human G protein-coupled receptor 37 (endothelin receptor type B-like) (GPR37)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR37 (NM_005302) Human Tagged ORF Clone
Symbol GPR37
Synonyms EDNRBL; hET(B)R-LP; PAELR
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG208054 representing NM_005302
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGAGCCCCGGGCGCGCTTCTCGCCCGCATGTCGCGGCTACTGCTTCTGCTACTGCTCAAGGTGTCTG
CCTCTTCTGCCCTCGGGGTCGCCCCTGCGTCCAGAAACGAAACTTGTCTGGGGGAGAGCTGTGCACCTAC
AGTGATCCAGCGCCGCGGCAGGGACGCCTGGGGACCGGGAAATTCTGCAAGAGACGTTCTGCGAGCCCGA
GCACCCAGGGAGGAGCAGGGGGCAGCGTTTCTTGCGGGACCCTCCTGGGACCTGCCGGCGGCCCCGGGCC
GTGACCCGGCTGCAGGCAGAGGGGCGGAGGCGTCGGCAGCCGGACCCCCGGGACCTCCAACCAGGCCACC
TGGCCCCTGGAGGTGGAAAGGTGCTCGGGGTCAGGAGCCTTCTGAAACTTTGGGGAGAGGGAACCCCACG
GCCCTCCAGCTCTTCCTTCAGATCTCAGAGGAGGAAGAGAAGGGTCCCAGAGGCGCTGGCATTTCCGGGC
GTAGCCAGGAGCAGAGTGTGAAGACAGTCCCCGGAGCCAGCGATCTTTTTTACTGGCCAAGGAGAGCCGG
GAAACTCCAGGGTTCCCACCACAAGCCCCTGTCCAAGACGGCCAATGGACTGGCGGGGCACGAAGGGTGG
ACAATTGCACTCCCGGGCCGGGCGCTGGCCCAGAATGGATCCTTGGGTGAAGGAATCCATGAGCCTGGGG
GTCCCCGCCGGGGAAACAGCACGAACCGGCGTGTGAGACTGAAGAACCCCTTCTACCCGCTGACCCAGGA
GTCCTATGGAGCCTACGCGGTCATGTGTCTGTCCGTGGTGATCTTCGGGACCGGCATCATTGGCAACCTG
GCGGTGATGTGCATCGTGTGCCACAACTACTACATGCGGAGCATCTCCAACTCCCTCTTGGCCAACCTGG
CCTTCTGGGACTTTCTCATCATCTTCTTCTGCCTTCCGCTGGTCATCTTCCACGAGCTGACCAAGAAGTG
GCTGCTGGAGGACTTCTCCTGCAAGATCGTGCCCTATATAGAGGTCGCTTCTCTGGGAGTCACCACCTTC
ACCTTATGTGCTCTGTGCATAGACCGCTTCCGTGCTGCCACCAACGTACAGATGTACTACGAAATGATCG
AAAACTGTTCCTCAACAACTGCCAAACTTGCTGTTATATGGGTGGGAGCTCTATTGTTAGCACTTCCAGA
AGTTGTTCTCCGCCAGCTGAGCAAGGAGGATTTGGGGTTTAGTGGCCGAGCTCCGGCAGAAAGGTGCATT
ATTAAGATCTCTCCTGATTTACCAGACACCATCTATGTTCTAGCCCTCACCTACGACAGTGCGAGACTGT
GGTGGTATTTTGGCTGTTACTTTTGTTTGCCCACGCTTTTCACCATCACCTGCTCTCTAGTGACTGCGAG
GAAAATCCGCAAAGCAGAGAAAGCCTGTACCCGAGGGAATAAACGGCAGATTCAACTAGAGAGTCAGATG
AACTGTACAGTAGTGGCACTGACCATTTTATATGGATTTTGCATTATTCCTGAAAATATCTGCAACATTG
TTACTGCCTACATGGCTACAGGGGTTTCACAGCAGACAATGGACCTCCTTAATATCATCAGCCAGTTCCT
TTTGTTCTTTAAGTCCTGTGTCACCCCAGTCCTCCTTTTCTGTCTCTGCAAACCCTTCAGTCGGGCCTTC
ATGGAGTGCTGCTGCTGTTGCTGTGAGGAATGCATTCAGAAGTCTTCAACGGTGACCAGTGATGACAATG
ACAACGAGTACACCACGGAACTCGAACTCTCGCCTTTCAGTACCATACGCCGTGAAATGTCCACTTTTGC
TTCTGTCGGAACTCATTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208054 representing NM_005302
Red=Cloning site Green=Tags(s)

MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRAR
APREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPT
ALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGW
TIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNL
AVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTF
TLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQM
NCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAF
MECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005302
ORF Size 1839 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005302.2, NP_005293
RefSeq Size 3815
RefSeq ORF 1842
Locus ID 2861
Cytogenetics 7q31.33
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Parkinson's disease
Gene Summary This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into G protein mediated intracellular effects. This gene product interacts with Parkin and is involved in juvenile Parkinson disease. [provided by RefSeq, Oct 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations