HSD11B2 (NM_000196) Human Tagged ORF Clone

CAT#: RG207796

HSD11B2 (GFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 2 (HSD11B2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HSD11B2 (NM_000196) Human Tagged ORF Clone
Symbol HSD11B2
Synonyms AME; AME1; HSD11K; HSD2; SDR9C3
Vector pCMV6-AC-GFP
Sequence Data
>RG207796 representing NM_000196
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGCTGGCCTTGGCCGTCGGGCGGCGCCTGGCTGCTCGTGGCTGCCCGCGCGCTGCTGCAGCTGC
TGCGCTCAGACCTGCGTCTGGGCCGCCCGCTGCTGGCGGCGCTGGCGCTGCTGGCCGCGCTCGACTGGCT
GTGCCAGCGCCTGCTGCCCCCGCCGGCCGCACTCGCCGTGCTGGCCGCCGCCGGCTGGATCGCGTTGTCC
CGCCTGGCGCGCCCGCAGCGCCTGCCGGTGGCCACTCGCGCGGTGCTCATCACCGGCTGTGACTCTGGTT
TTGGCAAGGAGACGGCCAAGAAACTGGACTCCATGGGCTTCACGGTGCTGGCCACCGTATTGGAGTTGAA
CAGCCCCGGTGCCATCGAGCTGCGTACCTGCTGCTCCCCTCGCCTAAGGCTGCTGCAGATGGACCTGACC
AAACCAGGAGACATTAGCCGCGTGCTAGAGTTCACCAAGGCCCACACCACCAGCACCGGCCTGTGGGGCC
TCGTCAACAACGCAGGCCACAATGAAGTAGTTGCTGATGCGGAGCTGTCTCCAGTGGCCACTTTCCGTAG
CTGCATGGAGGTGAATTTCTTTGGCGCGCTCGAGCTGACCAAGGGCCTCCTGCCCCTGCTGCGCAGCTCA
AGGGGCCGCATCGTGACTGTGGGGAGCCCAGCGGGGGACATGCCATATCCGTGCTTGGGGGCCTATGGAA
CCTCCAAAGCGGCCGTGGCGCTACTCATGGACACATTCAGCTGTGAACTCCTTCCCTGGGGGGTCAAGGT
CAGCATCATCCAGCCTGGCTGCTTCAAGACAGAGTCAGTGAGAAACGTGGGTCAGTGGGAAAAGCGCAAG
CAATTGCTGCTGGCCAACCTGCCTCAAGAGCTGCTGCAGGCCTACGGCAAGGACTACATCGAGCACTTGC
ATGGGCAGTTCCTGCACTCGCTACGCCTGGCCATGTCCGACCTCACCCCAGTTGTAGATGCCATCACAGA
TGCGCTGCTGGCAGCTCGGCCCCGCCGCCGCTATTACCCCGGCCAGGGCCTGGGGCTCATGTACTTCATC
CACTACTACCTGCCTGAAGGCCTGCGGCGCCGCTTCCTGCAGGCCTTCTTCATCAGTCACTGTCTGCCTC
GAGCACTGCAGCCTGGCCAGCCTGGCACTACCCCACCACAGGACGCAGCCCAGGGCCCAAACCTGAGCCC
CGGCCCTTCCCCAGCAGTGGCTCGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207796 representing NM_000196
Red=Cloning site Green=Tags(s)

MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALS
RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLT
KPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSS
RGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRK
QLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFI
HYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000196
ORF Size 1215 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000196.2, NP_000187
RefSeq Size 1944
RefSeq ORF 1218
Locus ID 3291
Cytogenetics 16q22.1
Protein Families Druggable Genome
Protein Pathways C21-Steroid hormone metabolism, Androgen and estrogen metabolism, Metabolic pathways
Gene Summary Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)