APJ Receptor (APLNR) (NM_005161) Human Tagged ORF Clone

CAT#: RG207576

Reviews ()
Write a review
  • TrueORF®

APLNR (GFP-tagged) - Human apelin receptor (APLNR), transcript variant 1



  "NM_005161" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name APJ Receptor (APLNR) (NM_005161) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol APLNR
Synonyms AGTRL1; APJ; APJR; HG11
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG207576 representing NM_005161
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAGGTGGTGATTTTGACAACTACTATGGGGCAGACAACCAGTCTGAGTGTGAGTACACAGACT
GGAAATCCTCGGGGGCCCTCATCCCTGCCATCTACATGTTGGTCTTCCTCCTGGGCACCACGGGCAACGG
TCTGGTGCTCTGGACCGTGTTTCGGAGCAGCCGGGAGAAGAGGCGCTCAGCTGATATCTTCATTGCTAGC
CTGGCGGTGGCTGACCTGACCTTCGTGGTGACGCTGCCCCTGTGGGCTACCTACACGTACCGGGACTATG
ACTGGCCCTTTGGGACCTTCTTCTGCAAGCTCAGCAGCTACCTCATCTTCGTCAACATGTACGCCAGCGT
CTTCTGCCTCACCGGCCTCAGCTTCGACCGCTACCTGGCCATCGTGAGGCCAGTGGCCAATGCTCGGCTG
AGGCTGCGGGTCAGCGGGGCCGTGGCCACGGCAGTTCTTTGGGTGCTGGCCGCCCTCCTGGCCATGCCTG
TCATGGTGTTACGCACCACCGGGGACTTGGAGAACACCACTAAGGTGCAGTGCTACATGGACTACTCCAT
GGTGGCCACTGTGAGCTCAGAGTGGGCCTGGGAGGTGGGCCTTGGGGTCTCGTCCACCACCGTGGGCTTT
GTGGTGCCCTTCACCATCATGCTGACCTGTTACTTCTTCATCGCCCAAACCATCGCTGGCCACTTCCGCA
AGGAACGCATCGAGGGCCTGCGGAAGCGGCGCCGGCTGCTCAGCATCATCGTGGTGCTGGTGGTGACCTT
TGCCCTGTGCTGGATGCCCTACCACCTGGTGAAGACGCTGTACATGCTGGGCAGCCTGCTGCACTGGCCC
TGTGACTTTGACCTCTTCCTCATGAACATCTTCCCCTACTGCACCTGCATCAGCTACGTCAACAGCTGCC
TCAACCCCTTCCTCTATGCCTTTTTCGACCCCCGCTTCCGCCAGGCCTGCACCTCCATGCTCTGCTGTGG
CCAGAGCAGGTGCGCAGGCACCTCCCACAGCAGCAGTGGGGAGAAGTCAGCCAGCTACTCTTCGGGGCAC
AGCCAGGGGCCCGGCCCCAACATGGGCAAGGGTGGAGAACAGATGCACGAGAAATCCATCCCCTACAGCC
AGGAGACCCTTGTGGTTGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207576 representing NM_005161
Red=Cloning site Green=Tags(s)

MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIAS
LAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARL
RLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGF
VVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWP
CDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGH
SQGPGPNMGKGGEQMHEKSIPYSQETLVVD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005161
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005161.3, NP_005152.1
RefSeq Size 3847 bp
RefSeq ORF 1143 bp
Locus ID 187
Cytogenetics 11q12.1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction
Gene Summary This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq, Jul 2009]

Citations (1)

Other Versions

Other products for "APLNR"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
    • 100 ul

USD 415.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools