APJ Receptor(APLNR) (NM_005161) Human Tagged ORF Clone

CAT#: RG207576

APLNR (GFP-tagged) - Human apelin receptor (APLNR), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name APJ Receptor(APLNR) (NM_005161) Human Tagged ORF Clone
Symbol APLNR
Synonyms AGTRL1; APJ; APJR; HG11
Vector pCMV6-AC-GFP
Sequence Data
>RG207576 representing NM_005161
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAGGTGGTGATTTTGACAACTACTATGGGGCAGACAACCAGTCTGAGTGTGAGTACACAGACT
GGAAATCCTCGGGGGCCCTCATCCCTGCCATCTACATGTTGGTCTTCCTCCTGGGCACCACGGGCAACGG
TCTGGTGCTCTGGACCGTGTTTCGGAGCAGCCGGGAGAAGAGGCGCTCAGCTGATATCTTCATTGCTAGC
CTGGCGGTGGCTGACCTGACCTTCGTGGTGACGCTGCCCCTGTGGGCTACCTACACGTACCGGGACTATG
ACTGGCCCTTTGGGACCTTCTTCTGCAAGCTCAGCAGCTACCTCATCTTCGTCAACATGTACGCCAGCGT
CTTCTGCCTCACCGGCCTCAGCTTCGACCGCTACCTGGCCATCGTGAGGCCAGTGGCCAATGCTCGGCTG
AGGCTGCGGGTCAGCGGGGCCGTGGCCACGGCAGTTCTTTGGGTGCTGGCCGCCCTCCTGGCCATGCCTG
TCATGGTGTTACGCACCACCGGGGACTTGGAGAACACCACTAAGGTGCAGTGCTACATGGACTACTCCAT
GGTGGCCACTGTGAGCTCAGAGTGGGCCTGGGAGGTGGGCCTTGGGGTCTCGTCCACCACCGTGGGCTTT
GTGGTGCCCTTCACCATCATGCTGACCTGTTACTTCTTCATCGCCCAAACCATCGCTGGCCACTTCCGCA
AGGAACGCATCGAGGGCCTGCGGAAGCGGCGCCGGCTGCTCAGCATCATCGTGGTGCTGGTGGTGACCTT
TGCCCTGTGCTGGATGCCCTACCACCTGGTGAAGACGCTGTACATGCTGGGCAGCCTGCTGCACTGGCCC
TGTGACTTTGACCTCTTCCTCATGAACATCTTCCCCTACTGCACCTGCATCAGCTACGTCAACAGCTGCC
TCAACCCCTTCCTCTATGCCTTTTTCGACCCCCGCTTCCGCCAGGCCTGCACCTCCATGCTCTGCTGTGG
CCAGAGCAGGTGCGCAGGCACCTCCCACAGCAGCAGTGGGGAGAAGTCAGCCAGCTACTCTTCGGGGCAC
AGCCAGGGGCCCGGCCCCAACATGGGCAAGGGTGGAGAACAGATGCACGAGAAATCCATCCCCTACAGCC
AGGAGACCCTTGTGGTTGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207576 representing NM_005161
Red=Cloning site Green=Tags(s)

MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIAS
LAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARL
RLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGF
VVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWP
CDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGH
SQGPGPNMGKGGEQMHEKSIPYSQETLVVD

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005161
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005161.3, NP_005152
RefSeq Size 3847
RefSeq ORF 1143
Locus ID 187
Cytogenetics 11q12.1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
Gene Summary Receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity and plays a role in various processes in adults such as regulation of blood pressure, heart contractility, and heart failure. Also plays a key role in early development such as gastrulation and heart morphogenesis by acting as a receptor for APELA hormone. Alternative coreceptor with CD4 for HIV-1 infection; may be involved in the development of AIDS dementia. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)