EXTL2 (NM_001439) Human Tagged ORF Clone

CAT#: RG207406

EXTL2 (GFP-tagged) - Human exostoses (multiple)-like 2 (EXTL2), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name EXTL2 (NM_001439) Human Tagged ORF Clone
Symbol EXTL2
Synonyms EXTR2
Vector pCMV6-AC-GFP
Sequence Data
>RG207406 representing NM_001439
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGTGTTGCCACATCTGCAAACTTCCTGGGAGAGTAATGGGGATTCGAGTGCTTCGATTATCTTTGG
TGGTCATCCTCGTATTATTACTGGTAGCTGGTGCTTTGACTGCCTTACTTCCCAGTGTTAAAGAAGACAA
GATGCTCATGTTGCGTAGGGAAATAAAATCCCAGGGCAAGTCCACCATGGACTCCTTTACTCTCATAATG
CAGACGTACAACAGAACAGATCTCTTATTGAAACTTTTAAATCATTATCAGGCTGTACCAAATCTGCACA
AAGTGATTGTGGTATGGAACAATATTGGAGAGAAGGCACCAGATGAATTATGGAATTCTCTAGGGCCCCA
CCCTATCCCTGTGATCTTCAAACAACAGACAGCAAACAGGATGAGAAATCGACTCCAGGTCTTTCCTGAA
CTGGAAACCAATGCAGTGTTGATGGTAGATGATGACACACTCATCAGCACCCCAGACCTTGTTTTTGCTT
TCTCAGTTTGGCAGCAATTTCCTGATCAAATTGTAGGATTTGTTCCTAGAAAGCACGTCTCTACTTCATC
AGGTATCTACAGTTATGGAAGTTTTGAAATGCAAGCACCAGGGTCTGGAAATGGTGACCAGTACTCTATG
GTGCTGATTGGAGCCTCATTCTTCAATAGCAAATATCTTGAATTATTTCAGAGGCAACCTGCAGCTGTCC
ATGCTTTGATAGATGATACTCAAAACTGTGATGATATTGCCATGAATTTTATCATTGCCAAGCATATTGG
CAAGACTTCAGGGATATTTGTGAAGCCTGTAAACATGGACAATTTGGAAAAAGAAACCAACAGTGGCTAT
TCTGGAATGTGGCATCGAGCTGAGCACGCTCTGCAGAGGTCTTATTGTATAAATAAGCTTGTTAATATCT
ATGATAGCATGCCCTTAAGATACTCCAACATTATGATTTCCCAGTTTGGTTTTCCATATGCCAACTACAA
AAGAAAAATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207406 representing NM_001439
Red=Cloning site Green=Tags(s)

MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIM
QTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPE
LETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSM
VLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGY
SGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001439
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001439.2, NP_001430
RefSeq Size 2905
RefSeq ORF 993
Locus ID 2135
Cytogenetics 1p21.2
Protein Families Transmembrane
Protein Pathways Heparan sulfate biosynthesis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)