Islet 1 (ISL1) (NM_002202) Human Tagged ORF Clone

CAT#: RG206893

Reviews ()
Write a review
  • TrueORF®

ISL1 (GFP-tagged) - Human ISL LIM homeobox 1 (ISL1)



  "NM_002202" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 657.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ISL1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ISL1
Synonyms Isl-1; ISLET1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG206893 representing NM_002202
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGACATGGGAGATCCACCAAAAAAAAAACGTCTGATTTCCCTATGTGTTGGTTGCGGCAATCAGA
TTCACGATCAGTATATTCTGAGGGTTTCTCCGGATTTGGAATGGCATGCGGCATGTTTGAAATGTGCGGA
GTGTAATCAGTATTTGGACGAGAGCTGTACATGCTTTGTTAGGGATGGGAAAACCTACTGTAAAAGAGAT
TATATCAGGTTGTACGGGATCAAATGCGCCAAGTGCAGCATCGGCTTCAGCAAGAACGACTTCGTGATGC
GTGCCCGCTCCAAGGTGTATCACATCGAGTGTTTCCGCTGTGTGGCCTGCAGCCGCCAGCTCATCCCTGG
GGACGAATTTGCGCTTCGGGAGGACGGTCTCTTCTGCCGAGCAGACCACGATGTGGTGGAGAGGGCCAGT
CTAGGCGCTGGCGACCCGCTCAGTCCCCTGCATCCAGCGCGGCCACTGCAAATGGCAGCGGAGCCCATCT
CCGCCAGGCAGCCGGCCCTGCGGCCCCACGTCCACAAGCAGCCGGAGAAGACCACCCGCGTGCGGACTGT
GCTGAACGAGAAGCAGCTGCACACCTTGCGGACCTGCTACGCCGCAAACCCGCGGCCAGATGCGCTCATG
AAGGAGCAACTGGTAGAGATGACGGGCCTCAGTCCCCGTGTGATCCGGGTCTGGTTTCAAAACAAGCGGT
GCAAGGACAAGAAGCGAAGCATCATGATGAAGCAACTCCAGCAGCAGCAGCCCAATGACAAAACTAATAT
CCAGGGGATGACAGGAACTCCCATGGTGGCTGCCAGTCCAGAGAGACACGACGGTGGCTTACAGGCTAAC
CCAGTGGAAGTACAAAGTTACCAGCCACCTTGGAAAGTACTGAGCGACTTCGCCTTGCAGAGTGACATAG
ATCAGCCTGCTTTTCAGCAACTGGTCAATTTTTCAGAAGGAGGACCGGGCTCTAATTCCACTGGCAGTGA
AGTAGCATCAATGTCCTCTCAACTTCCAGATACACCTAACAGCATGGTAGCCAGTCCTATTGAGGCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG206893 representing NM_002202
Red=Cloning site Green=Tags(s)

MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRD
YIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERAS
LGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALM
KEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQAN
PVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002202
ORF Size 1047 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002202.2, NP_002193.2
RefSeq Size 2729 bp
RefSeq ORF 1050 bp
Locus ID 3670
UniProt ID P61371
Cytogenetics 5q11.1
Protein Families ES Cell Differentiation/IPS, Transcription Factors
Gene Summary This gene encodes a member of the LIM/homeodomain family of transcription factors. The encoded protein binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. The encoded protein is central to the development of pancreatic cell lineages and may also be required for motor neuron generation. Mutations in this gene have been associated with maturity-onset diabetes of the young. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
    • 100 ul

USD 447.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.