MDC (CCL22) (NM_002990) Human Tagged ORF Clone

CAT#: RG206578

  • TrueORF®

CCL22 (tGFP-tagged) - Human chemokine (C-C motif) ligand 22 (CCL22)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_002990" in other vectors (6)

Reconstitution Protocol

USD 350.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


CCL22 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MDC
Synonyms A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG206578 representing NM_002990
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGCCTACAGACTGCACTCCTGGTTGTCCTCGTCCTCCTTGCTGTGGCGCTTCAAGCAACTGAGG
CAGGCCCCTACGGCGCCAACATGGAAGACAGCGTCTGCTGCCGTGATTACGTCCGTTACCGTCTGCCCCT
GCGCGTGGTGAAACACTTCTACTGGACCTCAGACTCCTGCCCGAGGCCTGGCGTGGTGTTGCTAACCTTC
AGGGATAAGGAGATCTGTGCCGATCCCAGAGTGCCCTGGGTGAAGATGATTCTCAATAAGCTGAGCCAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG206578 representing NM_002990
Red=Cloning site Green=Tags(s)

MARLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF
RDKEICADPRVPWVKMILNKLSQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002990
ORF Size 279 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002990.2
RefSeq Size 2918 bp
RefSeq ORF 282 bp
Locus ID 6367
UniProt ID O00626
Cytogenetics 16q21
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Gene Summary This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.