Macrophage Inflammatory Protein 3 beta(CCL19) (NM_006274) Human Tagged ORF Clone

CAT#: RG206523

CCL19 (GFP-tagged) - Human chemokine (C-C motif) ligand 19 (CCL19)

Change vector?

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Macrophage Inflammatory Protein 3 beta(CCL19) (NM_006274) Human Tagged ORF Clone
Symbol CCL19
Synonyms CKb11; ELC; MIP-3b; MIP3B; SCYA19
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG206523 representing NM_006274
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGCTACTGGCCCTCAGCCTGCTGGTTCTCTGGACTTCCCCAGCCCCAACTCTGAGTGGCACCA
ATGATGCTGAAGACTGCTGCCTGTCTGTGACCCAGAAACCCATCCCTGGGTACATCGTGAGGAACTTCCA
CTACCTTCTCATCAAGGATGGCTGCAGGGTGCCTGCTGTAGTGTTCACCACACTGAGGGGCCGCCAGCTC
TGTGCACCCCCAGACCAGCCCTGGGTAGAACGCATCATCCAGAGACTGCAGAGGACCTCAGCCAAGATGA
AGCGCCGCAGCAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206523 representing NM_006274
Red=Cloning site Green=Tags(s)

MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQL
CAPPDQPWVERIIQRLQRTSAKMKRRSS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_006274
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006274.2, NP_006265
RefSeq Size 684
Locus ID 6363
Cytogenetics 9p13.3
Protein Families Secreted Protein, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Chemokine signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.