Bonzo(CXCR6) (NM_006564) Human Tagged ORF Clone

CAT#: RG206517

CXCR6 (GFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Bonzo(CXCR6) (NM_006564) Human Tagged ORF Clone
Symbol CXCR6
Synonyms BONZO; CD186; STRL33; TYMSTR
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG206517 representing NM_006564
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGCATGATTACCATGAAGACTATGGGTTCAGCAGTTTCAATGACAGCAGCCAGGAGGAGCATC
AAGACTTCCTGCAGTTCAGCAAGGTCTTTCTGCCCTGCATGTACCTGGTGGTGTTTGTCTGTGGTCTGGT
GGGGAACTCTCTGGTGCTGGTCATATCCATCTTCTACCATAAGTTGCAGAGCCTGACGGATGTGTTCCTG
GTGAACCTACCCCTGGCTGACCTGGTGTTTGTCTGCACTCTGCCCTTCTGGGCCTATGCAGGCATCCATG
AATGGGTGTTTGGCCAGGTCATGTGCAAGAGCCTACTGGGCATCTACACTATTAACTTCTACACGTCCAT
GCTCATCCTCACCTGCATCACTGTGGATCGTTTCATTGTAGTGGTTAAGGCCACCAAGGCCTACAACCAG
CAAGCCAAGAGGATGACCTGGGGCAAGGTCACCAGCTTGCTCATCTGGGTGATATCCCTGCTGGTTTCCT
TGCCCCAAATTATCTATGGCAATGTCTTTAATCTCGACAAGCTCATATGTGGTTACCATGACGAGGCAAT
TTCCACTGTGGTTCTTGCCACCCAGATGACACTGGGGTTCTTCTTGCCACTGCTCACCATGATTGTCTGC
TATTCAGTCATAATCAAAACACTGCTTCATGCTGGAGGCTTCCAGAAGCACAGATCTCTAAAGATCATCT
TCCTGGTGATGGCTGTGTTCCTGCTGACCCAGATGCCCTTCAACCTCATGAAGTTCATCCGCAGCACACA
CTGGGAATACTATGCCATGACCAGCTTTCACTACACCATCATGGTGACAGAGGCCATCGCATACCTGAGG
GCCTGCCTTAACCCTGTGCTCTATGCCTTTGTCAGCCTGAAGTTTCGAAAGAACTTCTGGAAACTTGTGA
AGGACATTGGTTGCCTCCCTTACCTTGGGGTCTCACATCAATGGAAATCTTCTGAGGACAATTCCAAGAC
TTTTTCTGCCTCCCACAATGTGGAGGCCACCAGCATGTTCCAGTTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206517 representing NM_006564
Red=Cloning site Green=Tags(s)

MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFL
VNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQ
QAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVC
YSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLR
ACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_006564
ORF Size 1026 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006564.1, NP_006555
RefSeq Size 1953
RefSeq ORF 1029
Locus ID 10663
Cytogenetics 3p21.31
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Chemokine signaling pathway
Gene Summary Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations