ABCG1 (NM_016818) Human Tagged ORF Clone

CAT#: RG206478

ABCG1 (GFP-tagged) - Human ATP-binding cassette, sub-family G (WHITE), member 1 (ABCG1), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ABCG1 (NM_016818) Human Tagged ORF Clone
Symbol ABCG1
Synonyms ABC8; WHITE1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG206478 representing NM_016818
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGTCTGATGGCCGCTTTCTCGGTCGGCACCGCCATGAATGCCAGCAGTTACTCTGCAGAGATGA
CGGAGCCCAAGTCGGTGTGTGTCTCGGTGGATGAGGTGGTGTCCAGCAACATGGAGGCCACTGAGACGGA
CCTGCTGAATGGACATCTGAAAAAAGTAGATAATAACCTCACGGAAGCCCAGCGCTTCTCCTCCTTGCCT
CGGAGGGCAGCTGTGAACATTGAATTCAGGGACCTTTCCTATTCGGTTCCTGAAGGACCCTGGTGGAGGA
AGAAAGGATACAAGACCCTCCTGAAAGGAATTTCCGGGAAGTTCAATAGTGGTGAGTTGGTGGCCATTAT
GGGTCCTTCCGGGGCCGGGAAGTCCACGCTGATGAACATCCTGGCTGGATACAGGGAGACGGGCATGAAG
GGGGCCGTCCTCATCAACGGCCTGCCCCGGGACCTGCGCTGCTTCCGGAAGGTGTCCTGCTACATCATGC
AGGATGACATGCTGCTGCCGCATCTCACTGTGCAGGAGGCCATGATGGTGTCGGCACATCTGAAGCTTCA
GGAGAAGGATGAAGGCAGAAGGGAAATGGTCAAGGAGATACTGACAGCGCTGGGCTTGCTGTCTTGCGCC
AACACGCGGACCGGGAGCCTGTCAGGTGGTCAGCGCAAGCGCCTGGCCATCGCGCTGGAGCTGGTGAACA
ACCCTCCAGTCATGTTCTTCGATGAGCCCACCAGCGGCCTGGACAGCGCCTCCTGCTTCCAGGTGGTCTC
GCTGATGAAAGGGCTCGCTCAAGGGGGTCGCTCCATCATTTGCACCATCCACCAGCCCAGCGCCAAACTC
TTCGAGCTGTTCGACCAGCTTTACGTCCTGAGTCAAGGACAATGTGTGTACCGGGGAAAAGTCTGCAATC
TTGTGCCATATTTGAGGGATTTGGGTCTGAACTGCCCAACCTACCACAACCCAGCAGATTTTGTCATGGA
GGTTGCATCCGGCGAGTACGGTGATCAGAACAGTCGGCTGGTGAGAGCGGTTCGGGAGGGCATGTGTGAC
TCAGACCACAAGAGAGACCTCGGGGGTGATGCCGAGGTGAACCCTTTTCTTTGGCACCGGCCCTCTGAAG
AGGACTCCTCGTCCATGGAAGGCTGCCACAGCTTCTCTGCCAGCTGCCTCACGCAGTTCTGCATCCTCTT
CAAGAGGACCTTCCTCAGCATCATGAGGGACTCGGTCCTGACACACCTGCGCATCACCTCGCACATTGGG
ATCGGCCTCCTCATTGGCCTGCTGTACTTGGGGATCGGGAACGAAGCCAAGAAGGTCTTGAGCAACTCCG
GCTTCCTCTTCTTCTCCATGCTGTTCCTCATGTTCGCGGCCCTCATGCCTACTGTTCTGACATTTCCCCT
GGAGATGGGAGTCTTTCTTCGGGAACACCTGAACTACTGGTACAGCCTGAAGGCCTACTACCTGGCCAAG
ACCATGGCAGACGTGCCCTTTCAGATCATGTTCCCAGTGGCCTACTGCAGCATCGTGTACTGGATGACGT
CGCAGCCGTCCGACGCCGTGCGCTTTGTGCTGTTTGCCGCGCTGGGCACCATGACCTCCCTGGTGGCACA
GTCCCTGGGCCTGCTGATCGGAGCCGCCTCCACGTCCCTGCAGGTGGCCACTTTCGTGGGCCCAGTGACA
GCCATCCCGGTGCTCCTGTTCTCGGGGTTCTTCGTCAGCTTCGACACCATCCCCACGTACCTACAGTGGA
TGTCCTACATCTCCTATGTCAGGTATGGGTTCGAAGGGGTCATCCTCTCCATCTATGGCTTAGACCGGGA
AGATCTGCACTGTGACATCGACGAGACGTGCCACTTCCAGAAGTCGGAGGCCATCCTGCGGGAGCTGGAC
GTGGAAAATGCCAAGCTGTACCTGGACTTCATCGTACTCGGGATTTTCTTCATCTCCCTCCGCCTCATTG
CCTATTTTGTCCTCAGGTACAAAATCCGGGCAGAGAGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206478 representing NM_016818
Red=Cloning site Green=Tags(s)

MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLP
RRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMK
GAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEILTALGLLSCA
NTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKL
FELFDQLYVLSQGQCVYRGKVCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCD
SDHKRDLGGDAEVNPFLWHRPSEEDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDSVLTHLRITSHIG
IGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLNYWYSLKAYYLAK
TMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQSLGLLIGAASTSLQVATFVGPVT
AIPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIDETCHFQKSEAILRELD
VENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAER

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_016818
ORF Size 1998 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016818.2, NP_058198
RefSeq Size 2982
RefSeq ORF 2001
Locus ID 9619
Cytogenetics 21q22.3
Domains ABC_tran, AAA
Protein Families Transmembrane, Druggable Genome
Protein Pathways ABC transporters
Gene Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)