ATF1 (NM_005171) Human Tagged ORF Clone

CAT#: RG205923

  • TrueORF®

ATF1 (tGFP-tagged) - Human activating transcription factor 1 (ATF1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_005171" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
    • 100 ul

USD 447.00

Other products for "ATF1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ATF1
Synonyms EWS-ATF1; FUS/ATF-1; TREB36
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG205923 representing NM_005171
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGATTCCCACAAGAGTACCACGTCAGAGACAGCACCTCAACCTGGTTCAGCAGTTCAGGGAGCTC
ACATTTCTCATATTGCTCAACAGGTATCATCTTTATCAGAAAGTGAGGAGTCCCAGGACTCATCCGACAG
CATAGGCTCCTCACAGAAAGCCCACGGGATCCTAGCACGGCGCCCATCTTACAGAAAAATTTTGAAAGAC
TTATCTTCTGAAGATACACGGGGCAGAAAAGGAGACGGAGAAAATTCTGGAGTTTCTGCTGCTGTCACTT
CTATGTCTGTTCCAACTCCCATCTATCAGACTAGCAGCGGACAGTATATTGCCATTGCCCCAAATGGAGC
CTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGC
AGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCA
GCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGC
TACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGAT
GACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGA
AGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGA
AGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205923 representing NM_005171
Red=Cloning site Green=Tags(s)

MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKD
LSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSG
STQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTD
DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005171
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005171.2, NP_005162.1
RefSeq Size 1568 bp
RefSeq ORF 816 bp
Locus ID 466
UniProt ID P18846
Cytogenetics 12q13.12
Domains pKID, BRLZ
Protein Families Druggable Genome, Transcription Factors
Gene Summary This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related to growth, survival, and other cellular activities. This protein is phosphorylated at serine 63 in its kinase-inducible domain by serine/threonine kinases, cAMP-dependent protein kinase A, calmodulin-dependent protein kinase I/II, mitogen- and stress-activated protein kinase and cyclin-dependent kinase 3 (cdk-3). Its phosphorylation enhances its transactivation and transcriptional activities, and enhances cell transformation. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in angiomatoid fibrous histiocytoma and clear cell sarcoma. This gene has a pseudogene on chromosome 6. [provided by RefSeq, Aug 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.