HMG1(HMGB1) (NM_002128) Human Tagged ORF Clone

CAT#: RG205918

HMGB1 (GFP-tagged) - Human high mobility group box 1 (HMGB1)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HMG1(HMGB1) (NM_002128) Human Tagged ORF Clone
Symbol HMGB1
Synonyms HMG1; HMG3; SBP-1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG205918 representing NM_002128
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTC
GGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGA
GAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAAGCGGACAAGGCCCGT
TATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATG
CACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACA
TCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGAC
AAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATACGAAAAGGATATTGCTGCATATCGAG
CTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGA
GGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAA
GATGATGATGATGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205918 representing NM_002128
Red=Cloning site Green=Tags(s)

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE
DDDDE

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002128
ORF Size 645 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002128.4, NP_002119
RefSeq Size 3428
RefSeq ORF 648
Locus ID 3146
Cytogenetics 13q12.3
Domains HMG
Protein Families Stem cell - Pluripotency, Transcription Factors, Druggable Genome
Protein Pathways Base excision repair
Gene Summary This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.