EDEM1 (NM_014674) Human Tagged ORF Clone

CAT#: RG205655

EDEM1 (GFP-tagged) - Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EDEM1 (NM_014674) Human Tagged ORF Clone
Symbol EDEM1
Synonyms EDEM; EDEM
Vector pCMV6-AC-GFP
Sequence Data
>RG205655 representing NM_014674
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAATGGCGAGCGCTCGTCCTGGGGCTGGTGCTCCTCCGGCTTGGCCTCCATGGAGTATTGTGGCTCG
TCTTCGGGCTGGGGCCCAGCATGGGCTTCTACCAGCGCTTTCCGCTCAGCTTCGGCTTCCAGCGTCTGAG
GAGCCCCGACGGCCCCGCGTCGCCCACCTCGGGGCCCGTGGGCCGGCCTGGGGGGGTATCCGGGCCGTCG
TGGCTGCAGCCGCCGGGGACCGGGGCAGCGCAGAGCCCGCGCAAGGCTCCGCGGCGTCCTGGGCCGGGGA
TGTGCGGCCCAGCCAACTGGGGCTACGTGCTGGGCGGCCGGGGCCGCGGCCCGGACGAGTACGAGAAGCG
CTACAGCGGCGCCTTCCCTCCGCAGCTGCGTGCCCAGATGCGCGACCTGGCACGGGGCATGTTCGTCTTT
GGCTACGACAACTACATGGCTCACGCCTTCCCCCAGGACGAGCTCAACCCCATCCACTGCCGCGGCCGTG
GGCCCGACCGCGGGGACCCTTCAAATCTGAACATCAATGATGTACTAGGGAACTACTCATTGACTCTTGT
TGATGCATTGGATACACTTGCAATAATGGGAAATTCATCCGAGTTCCAGAAAGCAGTCAAGTTAGTGATC
AACACAGTTTCATTTGACAAAGATTCCACCGTCCAAGTCTTTGAGGCCACGATAAGGGTCCTGGGAAGCC
TCCTTTCTGCTCACAGAATAATAACTGACTCCAAGCAGCCCTTTGGTGACATGACAATTAAGGACTATGA
TAATGAGTTGTTATACATGGCCCATGACCTGGCGGTGCGGCTCCTCCCTGCTTTTGAAAACACCAAGACA
GGGATTCCATATCCTCGGGTGAATCTAAAGACAGGAGTTCCTCCTGACACCAATAATGAGACATGCACAG
CGGGAGCCGGTTCCCTCCTGGTGGAATTTGGGATTCTGAGTCGACTCCTGGGGGACTCCACATTTGAGTG
GGTGGCCAGACGAGCAGTGAAAGCCCTTTGGAACCTCCGGAGCAATGATACAGGATTACTAGGCAATGTC
GTGAACATTCAGACGGGCCACTGGGTTGGAAAGCAGAGTGGCCTGGGTGCCGGGCTGGACTCCTTCTATG
AATACCTCTTGAAATCTTACATTCTCTTTGGAGAAAAAGAAGACCTAGAAATGTTTAATGCTGCATATCA
GAGTATTCAGAACTACTTAAGAAGAGGGCGGGAAGCCTGCAATGAAGGAGAAGGAGACCCTCCACTCTAT
GTCAACGTGAACATGTTCAGTGGGCAGCTGATGAACACCTGGATTGACTCTCTGCAGGCCTTTTTCCCTG
GACTGCAGGTGCTGATAGGAGATGTGGAAGATGCCATCTGCCTTCATGCCTTCTACTATGCCATATGGAA
ACGATATGGTGCCCTCCCTGAGAGATATAACTGGCAGCTGCAGGCCCCTGACGTTCTCTTCTACCCACTG
AGACCAGAGTTAGTGGAATCCACATATCTCCTCTACCAGGCAACCAAGAATCCCTTCTACCTCCATGTAG
GAATGGATATTCTGCAGAGTCTGGAAAAGTACACAAAAGTCAAGTGTGGGTACGCCACGCTGCATCACGT
CATTGACAAGTCCACAGAAGACCGGATGGAGAGCTTCTTTCTCAGTGAGACCTGTAAATATTTGTATCTG
CTGTTTGATGAAGACAATCCAGTACACAAGTCTGGAACCAGATACATGTTCACAACAGAGGGACACATTG
TATCTGTGGATGAGCATCTTCGGGAATTGCCATGGAAGGAATTCTTCTCTGAAGAGGGAGGGCAGGACCA
AGGGGGAAAGTCTGTGCACAGGCCGAAACCTCATGAGTTAAAAGTCATCAACTCCAGCTCCAACTGCAAT
CGTGTACCTGATGAGAGGAGGTACTCCCTGCCCTTAAAGAGCATCTACATGCGACAGATTGACCAGATGG
TTGGTTTGATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205655 representing NM_014674
Red=Cloning site Green=Tags(s)

MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPVGRPGGVSGPS
WLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSGAFPPQLRAQMRDLARGMFVF
GYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVI
NTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKT
GIPYPRVNLKTGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV
VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDVLFYPL
RPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFLSETCKYLYL
LFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCN
RVPDERRYSLPLKSIYMRQIDQMVGLI

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_014674
ORF Size 1971 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014674.1, NP_055489
RefSeq Size 6072
RefSeq ORF 1974
Locus ID 9695
Cytogenetics 3p26.1
Domains Glyco_hydro_47
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.