HACE1 (NM_020771) Human Tagged ORF Clone

CAT#: RG205602

HACE1 (GFP-tagged) - Human HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 (HACE1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HACE1 (NM_020771) Human Tagged ORF Clone
Symbol HACE1
Synonyms HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Vector pCMV6-AC-GFP
Sequence Data
>RG205602 representing NM_020771
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGAGCGATGGAGCAACTCAACCGCCTGACGCGCTCGCTGCGCCACGCGCGCACCGTGGAGTTGC
CCGAGGATAATGAAACTGCTGTTTATACATTAATGCCAATGGTTATGGCTGATCAACACAGGTCTGTTTC
TGAACTACTATCAAATTCAAAATTTGATGTCAATTATGCATTCGGACGTGTGAAAAGAAGCTTGCTTCAC
ATTGCAGCAAATTGTGGATCGGTGGAATGCTTGGTTTTGCTGTTAAAGAAAGGAGCAAATCCTAACTATC
AAGATATTTCAGGCTGTACACCCCTTCATTTGGCAGCAAGAAATGGGCAGAAGAAATGTATGAGTAAATT
ATTAGAATATAGCGCTGATGTCAACATTTGTAATAATGAAGGCCTTACAGCAATACATTGGCTGGCTGTG
AATGGGCGGACAGAACTACTCCATGACCTTGTGCAGCATGTCAGTGATGTTGATGTTGAGGATGCCATGG
GGCAGACAGCACTGCATGTTGCCTGCCAGAACGGTCACAAGACGACAGTGCAGTGCTTGCTAGACAGTGG
TGCTGATATTAACAGGCCAAATGTATCAGGAGCAACTCCATTGTACTTTGCTTGCAGTCATGGTCAGAGA
GATACAGCACAGATCCTACTATTACGAGGAGCCAAATATCTGCCAGATAAAAATGGAGTAACTCCTCTGG
ATTTATGTGTACAGGGTGGATATGGAGAGACTTGTGAAGTATTAATTCAATATCACCCGAGGCTTTTTCA
GACTATTATTCAAATGACACAGAATGAAGACCTCCGAGAAAACATGTTACGGCAAGTTCTGGAGCATTTG
TCTCAGCAAAGTGAAAGCCAGTACCTAAAGATTCTAACAAGCCTTGCTGAAGTTGCTACAACAAATGGTC
ATAAACTGCTTAGCCTCTCTAGCAATTATGATGCTCAAATGAAGAGCCTTTTAAGGATTGTGAGAATGTT
TTGTCACGTCTTTCGAATTGGTCCATCCTCCCCCAGTAATGGAATTGATATGGGCTACAATGGGAATAAA
ACTCCAAGAAGCCAGGTGTTCAAGCCTCTGGAATTGCTTTGGCACTCGTTAGATGAATGGCTAGTTTTAA
CAGCCACAGAATTGATGAAAAACAAAAGAGACTCAACAGAGATCACTTCTATTTTACTGAAACAAAAAGG
CCAAGATCAAGATGCTGCTTCCATTCCTCCATTTGAACCTCCAGGACCTGGGAGCTATGAAAATCTGTCC
ACTGGCACAAGGGAATCTAAACCAGATGCTCTTGCAGGGAGACAGGAAGCCAGTGCAGATTGTCAGGATG
TTATTTCTATGACAGCTAACCGGCTAAGTGCTGTCATTCAAGCTTTTTACATGTGCTGTTCTTGTCAGAT
GCCTCCGGGAATGACTTCACCTCGTTTCATTGAATTTGTCTGCAAACATGATGAAGTTTTAAAATGCTTT
GTTAATAGAAATCCCAAAATTATATTTGACCACTTTCACTTTCTCCTTGAATGTCCTGAGTTGATGTCAA
GATTCATGCATATCATAAAAGCACAGCCTTTTAAAGATCGCTGTGAATGGTTCTATGAACATTTGCATTC
AGGACAGCCAGATTCAGATATGGTGCACAGGCCAGTGAATGAAAATGATATCCTGCTGGTTCACAGAGAT
TCTATTTTTAGGAGTAGCTGTGAAGTTGTGTCAAAAGCAAATTGTGCAAAGCTAAAGCAAGGGATTGCTG
TACGGTTCCATGGAGAAGAAGGCATGGGTCAAGGTGTTGTGCGTGAGTGGTTTGATATTCTGTCCAATGA
GATAGTCAATCCTGATTATGCATTGTTTACCCAGTCAGCTGATGGAACAACTTTTCAGCCTAATAGCAAC
TCTTATGTAAATCCTGATCACTTGAACTATTTTCGGTTTGCTGGGCAGATCTTGGGATTAGCGTTGAACC
ACAGGCAGCTGGTCAATATTTACTTCACACGATCCTTCTACAAGCACATTCTTGGTATTCCTGTAAATTA
CCAAGATGTGGCATCCATTGATCCAGAATATGCGAAAAATTTGCAATGGATTTTAGATAATGATATAAGT
GATCTGGGTCTAGAACTAACTTTTTCTGTTGAGACTGATGTGTTTGGAGCAATGGAAGAGGTGCCTTTGA
AACCTGGGGGTGGGAGTATTCTTGTGACACAAAATAATAAAGCGGAGTACGTCCAGCTTGTTACTGAACT
TCGAATGACAAGAGCCATTCAGCCTCAGATCAATGCTTTTTTACAGGGCTTTCATATGTTCATTCCACCC
TCCCTCATACAGCTTTTTGATGAATATGAATTGGAGCTACTGCTTTCTGGCATGCCAGAAATTGATGTGA
GTGATTGGATAAAAAATACAGAATACACAAGTGGCTATGAAAGAGAAGATCCAGTTATTCAGTGGTTCTG
GGAAGTTGTAGAAGACATTACTCAAGAGGAGAGAGTTCTTCTCTTACAGTTTGTTACGGGCAGTTCCAGG
GTCCCACATGGTGGGTTTGCTAATATCATGGGTGGAAGTGGATTGCAAAACTTTACAATCGCTGCTGTGC
CATATACTCCAAATCTTTTACCAACTTCAAGCACATGCATCAACATGCTCAAGTTACCTGAATACCCAAG
TAAAGAAATACTCAAGGACAGACTTCTTGTGGCACTACATTGTGGCAGCTATGGTTACACAATGGCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205602 representing NM_020771
Red=Cloning site Green=Tags(s)

MERAMEQLNRLTRSLRHARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKRSLLH
IAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEYSADVNICNNEGLTAIHWLAV
NGRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTVQCLLDSGADINRPNVSGATPLYFACSHGQR
DTAQILLLRGAKYLPDKNGVTPLDLCVQGGYGETCEVLIQYHPRLFQTIIQMTQNEDLRENMLRQVLEHL
SQQSESQYLKILTSLAEVATTNGHKLLSLSSNYDAQMKSLLRIVRMFCHVFRIGPSSPSNGIDMGYNGNK
TPRSQVFKPLELLWHSLDEWLVLTATELMKNKRDSTEITSILLKQKGQDQDAASIPPFEPPGPGSYENLS
TGTRESKPDALAGRQEASADCQDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFVCKHDEVLKCF
VNRNPKIIFDHFHFLLECPELMSRFMHIIKAQPFKDRCEWFYEHLHSGQPDSDMVHRPVNENDILLVHRD
SIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTTFQPNSN
SYVNPDHLNYFRFAGQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDIS
DLGLELTFSVETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPP
SLIQLFDEYELELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSR
VPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020771
ORF Size 2727 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020771.3, NP_065822
RefSeq Size 4576
RefSeq ORF 2730
Locus ID 57531
Cytogenetics 6q16.3
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)