RAB18 (NM_021252) Human Tagged ORF Clone

CAT#: RG205505

RAB18 (GFP-tagged) - Human RAB18, member RAS oncogene family (RAB18)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name RAB18 (NM_021252) Human Tagged ORF Clone
Symbol RAB18
Synonyms RAB18LI1; WARBM3
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG205505 representing NM_021252
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGAGGACGTGCTAACCACCCTGAAGATCCTCATCATCGGCGAGAGTGGGGTGGGCAAGTCCAGCC
TGCTCTTGAGGTTCACAGATGATACGTTTGATCCAGAACTTGCAGCAACAATAGGTGTTGACTTTAAGGT
GAAAACAATTTCAGTGGATGGAAATAAGGCTAAACTTGCAATATGGGATACTGCTGGTCAAGAGAGGTTT
AGAACATTAACTCCCAGCTATTATAGAGGTGCACAGGGTGTTATATTAGTTTATGATGTCACAAGAAGAG
ATACATTTGTTAAACTGGATAATTGGTTAAATGAATTGGAAACATACTGTACAAGAAATGACATAGTAAA
CATGCTAGTTGGAAATAAAATCGATAAGGAAAATCGTGAAGTCGATAGAAATGAAGGCCTGAAATTTGCA
CGAAAGCATTCCATGTTATTTATAGAGGCAAGTGCAAAAACCTGTGATGGTGTACAATGTGCCTTTGAAG
AACTTGTTGAAAAGATCATTCAGACCCCTGGACTGTGGGAAAGTGAGAACCAGAATAAAGGAGTCAAACT
GTCACACAGGGAAGAAGGCCAAGGAGGAGGAGCCTGTGGTGGTTATTGCTCTGTGTTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205505 representing NM_021252
Red=Cloning site Green=Tags(s)

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERF
RTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA
RKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_021252
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021252.3, NP_067075
RefSeq Size 2809
RefSeq ORF 621
Locus ID 22931
Cytogenetics 10p12.1
Domains ras, RAN, RAS, RHO, RAB, ARF
Protein Families Druggable Genome
Gene Summary The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.