Aquaporin 1 (AQP1) (NM_198098) Human Tagged ORF Clone

CAT#: RG205304

Reviews ()
Write a review
  • TrueORF®

AQP1 (GFP-tagged) - Human aquaporin 1 (Colton blood group) (AQP1), transcript variant 1



  "NM_198098" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Aquaporin 1 (AQP1) (NM_198098) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AQP1
Synonyms AQP-CHIP; CHIP28; CO
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG205304 representing NM_198098
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGCGAGTTCAAGAAGAAGCTCTTCTGGAGGGCAGTGGTGGCCGAGTTCCTGGCCACGACCCTCT
TTGTCTTCATCAGCATCGGTTCTGCCCTGGGCTTCAAATACCCGGTGGGGAACAACCAGACGACGGTCCA
GGACAACGTGAAGGTGTCGCTGGCCTTCGGGCTGAGCATCGCCACGCTGGCGCAGAGTGTGGGCCACATC
AGCGGCGCCCACCTCAACCCGGCTGTCACACTGGGGCTGCTGCTCAGCTGCCAGATCAGCATCTTCCGTG
CCCTCATGTACATCATCGCCCAGTGCGTGGGGGCCATCGTCGCCACCGCCATCCTCTCAGGCATCACCTC
CTCCCTGACTGGGAACTCGCTTGGCCGCAATGACCTGGCTGATGGTGTGAACTCGGGCCAGGGCCTGGGC
ATCGAGATCATCGGGACCCTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACC
TTGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTAGCCCTTGGACACCTCCTGGCTATTGACTACAC
TGGCTGTGGGATTAACCCTGCTCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTCAGCAACCACTGG
ATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGTACTCATCTACGACTTCATCCTGGCCCCAC
GCAGCAGTGACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGACCTGGATGC
CGACGACATCAACTCCAGGGTGGAGATGAAGCCCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205304 representing NM_198098
Red=Cloning site Green=Tags(s)

MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI
SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG
IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW
IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_198098
ORF Size 807 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_198098.1, NP_932766.1
RefSeq Size 2764 bp
RefSeq ORF 810 bp
Locus ID 358
Cytogenetics 7p14.3
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Gene Summary This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016]

Citations (2)

Other Versions

Other products for "AQP1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


AQP1 (Aquaporin 1) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools