TBK1(TBK1) (NM_013254) Human Tagged ORF Clone

CAT#: RG205238

TBK1 (GFP-tagged) - Human TANK-binding kinase 1 (TBK1)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TBK1(TBK1) (NM_013254) Human Tagged ORF Clone
Symbol TBK1
Synonyms NAK; T2K
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG205238 representing NM_013254
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAGCACTTCTAATCATCTGTGGCTTTTATCTGATATTTTAGGCCAAGGAGCTACTGCAAATGTCT
TTCGTGGAAGACATAAGAAAACTGGTGATTTATTTGCTATCAAAGTATTTAATAACATAAGCTTCCTTCG
TCCAGTGGATGTTCAAATGAGAGAATTTGAAGTGTTGAAAAAACTCAATCACAAAAATATTGTCAAATTA
TTTGCTATTGAAGAGGAGACAACAACAAGACATAAAGTACTTATTATGGAATTTTGTCCATGTGGGAGTT
TATACACTGTTTTAGAAGAACCTTCTAATGCCTATGGACTACCAGAATCTGAATTCTTAATTGTTTTGCG
AGATGTGGTGGGTGGAATGAATCATCTACGAGAGAATGGTATAGTGCACCGTGATATCAAGCCAGGAAAT
ATCATGCGTGTTATAGGGGAAGATGGACAGTCTGTGTACAAACTCACAGATTTTGGTGCAGCTAGAGAAT
TAGAAGATGATGAGCAGTTTGTTTCTCTGTATGGCACAGAAGAATATTTGCACCCTGATATGTATGAGAG
AGCAGTGCTAAGAAAAGATCATCAGAAGAAATATGGAGCAACAGTTGATCTTTGGAGCATTGGGGTAACA
TTTTACCATGCAGCTACTGGATCACTGCCATTTAGACCCTTTGAAGGGCCTCGTAGGAATAAAGAAGTGA
TGTATAAAATAATTACAGGAAAGCCTTCTGGTGCAATATCTGGAGTACAGAAAGCAGAAAATGGACCAAT
TGACTGGAGTGGAGACATGCCTGTTTCTTGCAGTCTTTCTCGGGGTCTTCAGGTTCTACTTACCCCTGTT
CTTGCAAACATCCTTGAAGCAGATCAGGAAAAGTGTTGGGGTTTTGACCAGTTTTTTGCAGAAACTAGTG
ATATACTTCACCGAATGGTAATTCATGTTTTTTCGCTACAACAAATGACAGCTCATAAGATTTATATACA
TAGCTATAATACTGCTACTATATTTCATGAACTGGTATATAAACAAACCAAAATTATTTCTTCAAATCAA
GAACTTATCTACGAAGGGCGACGCTTAGTCTTAGAACCTGGAAGGCTGGCACAACATTTCCCTAAAACTA
CTGAGGAAAACCCTATATTTGTAGTAAGCCGGGAACCTCTGGATACCATAGGATTAATATATGAAAAAAT
TTCCCTCCCTAAAGTACATCCACGTTATGATTTAGACGGGGATGCTAGCATGGCTAAGGCAATAACAGGG
GTTGTGTGTTATGCCTGCAGAATTGCCAGTACCTTACTGCTTTATCAGGAATTAATGCGAAAGGGGATAC
GATGGCTGATTGAATTAATTAAAGATGATTACAATGAAACTGTTCACAAAAAGACAGAAGTTGTGATCAC
ATTGGATTTCTGTATCAGAAACATTGAAAAAACTGTGAAAGTATATGAAAAGTTGATGAAGATCAACCTG
GAAGCGGCAGAGTTAGGTGAAATTTCAGACATACACACCAAATTGTTGAGACTTTCCAGTTCTCAGGGAA
CAATAGAAACCAGTCTTCAGGATATCGACAGCAGATTATCTCCAGGTGGATCACTGGCAGACGCATGGGC
ACATCAAGAAGGCACTCATCCGAAAGACAGAAATGTAGAAAAACTACAAGTCCTGTTAAATTGCATGACA
GAGATTTACTATCAGTTCAAAAAAGACCAAGCAGAACGTAGATTAGCTTATAATGAAGAACAAATCCACA
AATTTGATAAGCAAAAACTGTATTACCATGCCACAAAAGCTATGACGCACTTTACAGATGAATGTGTTAA
AAAGTATGAGGCATTTTTGAATAAGTCAGAAGAATGGATAAGAAAGATGCTTCATCTTAGGAAACAGTTA
TTATCGCTGACTAATCAGTGTTTTGATATTGAAGAAGAAGTATCAAAATATCAAGAATATACTAATGAGT
TACAAGAAACTCTGCCTCAGAAAATGTTTACAGCTTCCAGTGGAATCAAACATACCATGACCCCAATTTA
TCCAAGTTCTAACACATTAGTAGAAATGACTCTTGGTATGAAGAAATTAAAGGAAGAGATGGAAGGGGTG
GTTAAAGAACTTGCTGAAAATAACCACATTTTAGAAAGGTTTGGCTCTTTAACCATGGATGGTGGCCTTC
GCAACGTTGACTGTCTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205238 representing NM_013254
Red=Cloning site Green=Tags(s)

MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL
FAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGN
IMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVT
FYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPV
LANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQ
ELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLDTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINL
EAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMT
EIYYQFKKDQAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQL
LSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGV
VKELAENNHILERFGSLTMDGGLRNVDCL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_013254
ORF Size 2187 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013254.2, NP_037386
RefSeq Size 2982
Locus ID 29110
Cytogenetics 12q14.2
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway
Gene Summary The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. [provided by RefSeq, Oct 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.