Somatostatin Receptor 2(SSTR2) (NM_001050) Human Tagged ORF Clone

CAT#: RG205146

SSTR2 (GFP-tagged) - Human somatostatin receptor 2 (SSTR2)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Somatostatin Receptor 2(SSTR2) (NM_001050) Human Tagged ORF Clone
Symbol SSTR2
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG205146 representing NM_001050
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACATGGCGGATGAGCCACTCAATGGAAGCCACACATGGCTATCCATTCCATTTGACCTCAATGGCT
CTGTGGTGTCAACCAACACCTCAAACCAGACAGAGCCGTACTATGACCTGACAAGCAATGCAGTCCTCAC
ATTCATCTATTTTGTGGTCTGCATCATTGGGTTGTGTGGCAACACACTTGTCATTTATGTCATCCTCCGC
TATGCCAAGATGAAGACCATCACCAACATTTACATCCTCAACCTGGCCATCGCAGATGAGCTCTTCATGC
TGGGTCTGCCTTTCTTGGCTATGCAGGTGGCTCTGGTCCACTGGCCCTTTGGCAAGGCCATTTGCCGGGT
GGTCATGACTGTGGATGGCATCAATCAGTTCACCAGCATCTTCTGCCTGACAGTCATGAGCATCGACCGA
TACCTGGCTGTGGTCCACCCCATCAAGTCGGCCAAGTGGAGGAGACCCCGGACGGCCAAGATGATCACCA
TGGCTGTGTGGGGAGTCTCTCTGCTGGTCATCTTGCCCATCATGATATATGCTGGGCTCCGGAGCAACCA
GTGGGGGAGAAGCAGCTGCACCATCAACTGGCCAGGTGAATCTGGGGCTTGGTACACAGGGTTCATCATC
TACACTTTCATTCTGGGGTTCCTGGTACCCCTCACCATCATCTGTCTTTGCTACCTGTTCATTATCATCA
AGGTGAAGTCCTCTGGAATCCGAGTGGGCTCCTCTAAGAGGAAGAAGTCTGAGAAGAAGGTCACCCGAAT
GGTGTCCATCGTGGTGGCTGTCTTCATCTTCTGCTGGCTTCCCTTCTACATATTCAACGTTTCTTCCGTC
TCCATGGCCATCAGCCCCACCCCAGCCCTTAAAGGCATGTTTGACTTTGTGGTGGTCCTCACCTATGCTA
ACAGCTGTGCCAACCCTATCCTATATGCCTTCTTGTCTGACAACTTCAAGAAGAGCTTCCAGAATGTCCT
CTGCTTGGTCAAGGTGAGCGGCACAGATGATGGGGAGCGGAGTGACAGTAAGCAGGACAAATCCCGGCTG
AATGAGACCACGGAGACCCAGAGGACCCTCCTCAATGGAGACCTCCAAACCAGTATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205146 representing NM_001050
Red=Cloning site Green=Tags(s)

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILR
YAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDR
YLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFII
YTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSV
SMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRL
NETTETQRTLLNGDLQTSI

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001050
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001050.1, NP_001041
RefSeq Size 1110
Locus ID 6752
Cytogenetics 17q25.1
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
Gene Summary Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.