CBR1 (NM_001757) Human Tagged ORF Clone

CAT#: RG204950

CBR1 (GFP-tagged) - Human carbonyl reductase 1 (CBR1)

Change vector?

  • TrueORF®

USD 546


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CBR1 (NM_001757) Human Tagged ORF Clone
Symbol CBR1
Synonyms CBR; hCBR1; SDR21C1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG204950 representing NM_001757
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCCGGCATCCATGTAGCGCTGGTGACTGGAGGCAACAAGGGCATCGGCTTGGCCATCGTGCGCG
ACCTGTGCCGGCTGTTCTCGGGGGACGTGGTGCTCACGGCGCGGGACGTGACGCGGGGCCAGGCGGCCGT
ACAGCAGCTGCAGGCGGAGGGCCTGAGCCCGCGCTTCCACCAGCTGGACATCGACGATCTGCAGAGCATC
CGCGCCCTGCGCGACTTCCTGCGCAAGGAGTACGGGGGCCTGGACGTGCTGGTCAACAACGCGGGCATCG
CCTTCAAGGTTGCTGATCCCACACCCTTTCATATTCAAGCTGAAGTGACGATGAAAACAAATTTCTTTGG
TACCCGAGATGTGTGCACAGAATTACTCCCTCTAATAAAACCCCAAGGGAGAGTGGTGAACGTATCTAGC
ATCATGAGCGTCAGAGCCCTTAAAAGCTGCAGCCCAGAGCTGCAGCAGAAGTTCCGCAGTGAGACCATCA
CTGAGGAGGAGCTGGTGGGGCTCATGAACAAGTTTGTGGAGGATACAAAGAAGGGAGTGCACCAGAAGGA
GGGCTGGCCCAGCAGCGCATACGGGGTGACGAAGATTGGCGTCACCGTTCTGTCCAGGATCCACGCCAGG
AAACTGAGTGAGCAGAGGAAAGGGGACAAGATCCTCCTGAATGCCTGCTGCCCAGGGTGGGTGAGAACTG
ACATGGCGGGACCCAAGGCCACCAAGAGCCCAGAAGAAGGTGCAGAGACCCCTGTGTACTTGGCCCTTTT
GCCCCCAGATGCTGAGGGTCCCCATGGACAATTTGTTTCAGAGAAGAGAGTTGAACAGTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204950 representing NM_001757
Red=Cloning site Green=Tags(s)

MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI
RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS
IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR
KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001757
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001757.2, NP_001748
RefSeq Size 1245
RefSeq ORF 834
Locus ID 873
Cytogenetics 21q22.12
Domains adh_short
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
Gene Summary The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations