Endothelin B Receptor(EDNRB) (NM_000115) Human Tagged ORF Clone

CAT#: RG204899

EDNRB (GFP-tagged) - Human endothelin receptor type B (EDNRB), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 618.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Endothelin B Receptor(EDNRB) (NM_000115) Human Tagged ORF Clone
Symbol EDNRB
Synonyms ABCDS; ET-B; ET-BR; ETB; ETBR; ETRB; HSCR; HSCR2; WS4A
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG204899 representing NM_000115
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCGCCTCCAAGTCTGTGCGGACGCGCCCTGGTTGCGCTGGTTCTTGCCTGCGGCCTGTCGCGGA
TCTGGGGAGAGGAGAGAGGCTTCCCGCCTGACAGGGCCACTCCGCTTTTGCAAACCGCAGAGATAATGAC
GCCACCCACTAAGACCTTATGGCCCAAGGGTTCCAACGCCAGTCTGGCGCGGTCGTTGGCACCTGCGGAG
GTGCCTAAAGGAGACAGGACGGCAGGATCTCCGCCACGCACCATCTCCCCTCCCCCGTGCCAAGGACCCA
TCGAGATCAAGGAGACTTTCAAATACATCAACACGGTTGTGTCCTGCCTTGTGTTCGTGCTGGGGATCAT
CGGGAACTCCACACTTCTGAGAATTATCTACAAGAACAAGTGCATGCGAAACGGTCCCAATATCTTGATC
GCCAGCTTGGCTCTGGGAGACCTGCTGCACATCGTCATTGACATCCCTATCAATGTCTACAAGCTGCTGG
CAGAGGACTGGCCATTTGGAGCTGAGATGTGTAAGCTGGTGCCTTTCATACAGAAAGCCTCCGTGGGAAT
CACTGTGCTGAGTCTATGTGCTCTGAGTATTGACAGATATCGAGCTGTTGCTTCTTGGAGTAGAATTAAA
GGAATTGGGGTTCCAAAATGGACAGCAGTAGAAATTGTTTTGATTTGGGTGGTCTCTGTGGTTCTGGCTG
TCCCTGAAGCCATAGGTTTTGATATAATTACGATGGACTACAAAGGAAGTTATCTGCGAATCTGCTTGCT
TCATCCCGTTCAGAAGACAGCTTTCATGCAGTTTTACAAGACAGCAAAAGATTGGTGGCTGTTCAGTTTC
TATTTCTGCTTGCCATTGGCCATCACTGCATTTTTTTATACACTAATGACCTGTGAAATGTTGAGAAAGA
AAAGTGGCATGCAGATTGCTTTAAATGATCACCTAAAGCAGAGACGGGAAGTGGCCAAAACCGTCTTTTG
CCTGGTCCTTGTCTTTGCCCTCTGCTGGCTTCCCCTTCACCTCAGCAGGATTCTGAAGCTCACTCTTTAT
AATCAGAATGATCCCAATAGATGTGAACTTTTGAGCTTTCTGTTGGTATTGGACTATATTGGTATCAACA
TGGCTTCACTGAATTCCTGCATTAACCCAATTGCTCTGTATTTGGTGAGCAAAAGATTCAAAAACTGCTT
TAAGTCATGCTTATGCTGCTGGTGCCAGTCATTTGAAGAAAAACAGTCCTTGGAGGAAAAGCAGTCGTGC
TTAAAGTTCAAAGCTAATGATCACGGATATGACAACTTCCGTTCCAGTAATAAATACAGCTCATCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204899 representing NM_000115
Red=Cloning site Green=Tags(s)

MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAE
VPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILI
ASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIK
GIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSF
YFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLY
NQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000115
ORF Size 1326 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000115.1, NP_000106
RefSeq Size 4286
RefSeq ORF 1329
Locus ID 1910
Cytogenetics 13q22.3
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction, Melanogenesis
Gene Summary The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)