CD160 (NM_007053) Human Tagged ORF Clone

CAT#: RG204886

CD160 (tGFP-tagged) - Human CD160 molecule (CD160)

Product Images

Circular map for RG204886

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: CD160
• Synonyms: BY55; NK1; NK28
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG204886 representing NM_007053
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTGTTGGAACCCGGCAGAGGCTGCTGTGCCCTGGCCATCCTGCTGGCAATTGTGGACATCCAGTCTG
  GTGGATGCATTAACATCACCAGCTCAGCTTCCCAGGAAGGAACGCGACTAAACTTAATCTGTACTGTATG
  GCATAAGAAAGAAGAGGCTGAGGGGTTTGTAGTGTTTTTGTGCAAGGACAGGTCTGGAGACTGTTCTCCT
  GAGACCAGTTTAAAACAGCTGAGACTTAAAAGGGATCCTGGGATAGATGGTGTTGGTGAAATATCATCTC
  AGTTGATGTTCACCATAAGCCAAGTCACACCGTTGCACAGTGGGACCTACCAGTGTTGTGCCAGAAGCCA
  GAAGTCAGGTATCCGCCTTCAGGGCCATTTTTTCTCCATTCTATTCACAGAGACAGGGAACTACACAGTG
  ACGGGATTGAAACAAAGACAACACCTTGAGTTCAGCCATAATGAAGGCACTCTCAGTTCAGGCTTCCTAC
  AAGAAAAGGTCTGGGTAATGCTGGTCACCAGCCTTGTGGCCCTTCAAGCTTTG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG204886 representing NM_007053
  Red=Cloning site Green=Tags(s)
  
  MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSP
  ETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTV
  TGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_007053
• ORF Size: 543 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_007053.4
• RefSeq Size: 1559 bp
• RefSeq ORF: 546 bp
• Locus ID: 11126
• UniProt ID: O95971
• Cytogenetics: 1q21.1
• Protein Families: Druggable Genome
• Gene Summary: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008]