CDA08 (ITFG1) (NM_030790) Human Tagged ORF Clone

CAT#: RG204773

Reviews ()
Write a review
  • TrueORF®

ITFG1 (GFP-tagged) - Human integrin alpha FG-GAP repeat containing 1 (ITFG1)



  "NM_030790" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 770.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ITFG1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ITFG1
Synonyms 2310047C21Rik; CDA08; LNKN-1; TIP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG204773 representing NM_030790
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCGGGCCGGCTCCCGAGCTCCTGGGCCCTCTTCTCGCCGCTCCTCGCAGGGCTTGCACTAC
TGGGAGTCGGGCCGGTCCCAGCGCGGGCGCTGCACAACGTCACGGCCGAGCTCTTTGGGGCCGAGGCCTG
GGGCACCCTTGCGGCTTTCGGGGACCTCAACTCCGACAAGCAGACGGATCTCTTCGTGCTGCGGGAAAGA
AATGACTTAATCGTCTTTTTGGCAGACCAGAATGCACCCTATTTTAAACCCAAAGTAAAGGTATCTTTCA
AGAATCACAGTGCATTGATAACAAGTGTAGTCCCTGGGGATTATGATGGAGATTCTCAAATGGATGTCCT
TCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGGGGACAAAATCAA
ACATTAGATCCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCA
ATGGTGATCTAATTCCTGATATTTTTGGTATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGG
GAATTTATCATGGCATCCAGCATTGACCACTACAAGTAAAATGCGAATTCCACATTCTCATGCATTTATT
GATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAATGCCACCACTAGTACCTTCCAGT
TTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATGAT
GGTGGTTGGACAGTCAGCATTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGT
GAAGATAAAAATTGCCAAAAGAGTACCATCTACTTAGTGAGATCTGGGATGAAGCAGTGGGTTCCAGTCC
TACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTTGTGCCATTTGTGGATGAACAGCAACCAACTGA
AATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGACGCTCTGGTCATA
CTAAAGAACACATCTGGAAGCAACCAGCAGGCCTTTTTACTGGAGAACGTCCCTTGTAATAATGCAAGCT
GTGAAGAGGCGCGTCGAATGTTTAAAGTCTACTGGGAGCTGACAGACCTAAATCAAATTAAGGATGCCAT
GGTTGCCACCTTCTTTGACATTTACGAAGATGGAATCTTGGACATTGTAGTGCTAAGTAAAGGATATACA
AAGAATGATTTTGCCATTCATACACTAAAAAATAACTTTGAAGCAGATGCTTATTTTGTTAAAGTTATTG
TTCTTAGTGGTCTGTGTTCTAATGACTGTCCTCGTAAGATAACACCCTTTGGAGTGAATCAACCTGGACC
TTATATCATGTATACAACTGTAGATGCAAATGGGTATCTGAAAAATGGATCAGCTGGCCAACTCAGCCAA
TCCGCACATTTAGCTCTCCAACTACCATACAACGTGCTTGGTTTAGGTCGGAGCGCAAATTTTCTTGACC
ATCTCTACGTTGGTATTCCCCGTCCATCTGGAGAAAAATCTATACGAAAACAAGAGTGGACTGCAATCAT
TCCAAATTCCCAGCTAATTGTCATTCCATACCCTCACAATGTCCCTCGAAGTTGGAGTGCCAAACTGTAT
CTTACACCAAGTAATATTGTTCTGCTTACTGCTATAGCTCTCATCGGTGTCTGTGTTTTCATCTTGGCAA
TAATTGGCATTTTACATTGGCAGGAAAAGAAAGCAGATGATAGAGAAAAACGACAAGAAGCCCACCGGTT
TCATTTTGATGCTATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204773 representing NM_030790
Red=Cloning site Green=Tags(s)

MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRER
NDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQ
TLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFI
DLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGC
EDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVI
LKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYT
KNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQ
SAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLY
LTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_030790
ORF Size 1836 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_030790.5
RefSeq Size 2262 bp
RefSeq ORF 1839 bp
Locus ID 81533
UniProt ID Q8TB96
Cytogenetics 16q12.1
Domains FG-GAP
Protein Families Secreted Protein, Transmembrane
Gene Summary Modulator of T-cell function. Has a protective effect in graft versus host disease model (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Rabbit Polyclonal Anti-ITFG1 Antibody
    • 100 ul

USD 539.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.