GSTA3 (NM_000847) Human Tagged ORF Clone

CAT#: RG204624

GSTA3 (tGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3)

Product Images

Circular map for RG204624

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: GSTA3
• Synonyms: GSTA3-3; GTA3
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG204624 representing NM_000847
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGGGAAGCCCAAGCTTCACTACTTCAATGGACGGGGCAGAATGGAGCCCATCCGGTGGCTCTTGG
  CTGCAGCTGGAGTGGAGTTTGAAGAGAAATTTATAGGATCTGCAGAAGATTTGGGAAAGTTAAGAAATGA
  TGGGAGTTTGATGTTCCAGCAAGTACCAATGGTTGAGATTGATGGGATTAAGTTGGTACAGACCAGAGCC
  ATTCTCAACTACATTGCCAGCAAATACAACCTCTACGGGAAAGACATAAAGGAGAGAGCCCTAATTGATA
  TGTATACAGAAGGTATGGCAGATTTGAATGAAATGATCCTTCTTCTGCCCTTATGTCGACCTGAGGAAAA
  AGATGCCAAGATTGCCTTGATCAAAGAGAAAACAAAAAGTCGCTATTTCCCTGCCTTCGAAAAAGTGTTA
  CAGAGCCATGGACAAGACTACCTTGTTGGCAACAAGCTGAGCCGGGCTGACATTAGCCTGGTGGAACTTC
  TCTACTATGTGGAAGAGCTTGACTCCAGCCTTATCTCCAACTTCCCTCTGCTGAAGGCCCTGAAAACCAG
  AATCAGCAACCTGCCCACGGTGAAGAAGTTTCTACAGCCTGGCAGCCCAAGGAAGCCTCCCGCAGATGCA
  AAAGCTTTAGAAGAAGCCAGAAAGATTTTCAGGTTT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG204624 representing NM_000847
  Red=Cloning site Green=Tags(s)
  
  MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRA
  ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL
  QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA
  KALEEARKIFRF
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000847
• ORF Size: 666 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000847.2
• RefSeq Size: 937 bp
• RefSeq ORF: 669 bp
• Locus ID: 2940
• UniProt ID: Q16772
• Cytogenetics: 6p12.2
• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
• Gene Summary: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]