MELK (NM_014791) Human Tagged ORF Clone

CAT#: RG204245

MELK (GFP-tagged) - Human maternal embryonic leucine zipper kinase (MELK)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MELK (NM_014791) Human Tagged ORF Clone
Symbol MELK
Synonyms HPK38; HPK38
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG204245 representing NM_014791
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGATTATGATGAACTTCTCAAATATTATGAATTACATGAAACTATTGGGACAGGTGGCTTTGCAA
AGGTCAAACTTGCCTGCCATATCCTTACTGGAGAGATGGTAGCTATAAAAATCATGGATAAAAACACACT
AGGGAGTGATTTGCCCCGGATCAAAACGGAGATTGAGGCCTTGAAGAACCTGAGACATCAGCATATATGT
CAACTCTACCATGTGCTAGAGACAGCCAACAAAATATTCATGGTTCTTGAGTACTGCCCTGGAGGAGAGC
TGTTTGACTATATAATTTCCCAGGATCGCCTGTCAGAAGAGGAGACCCGGGTTGTCTTCCGTCAGATAGT
ATCTGCTGTTGCTTATGTGCACAGCCAGGGCTATGCTCACAGGGACCTCAAGCCAGAAAATTTGCTGTTT
GATGAATATCATAAATTAAAGCTGATTGACTTTGGTCTCTGTGCAAAACCCAAGGGTAACAAGGATTACC
ATCTACAGACATGCTGTGGGAGTCTGGCTTATGCAGCACCTGAGTTAATACAAGGCAAATCATATCTTGG
ATCAGAGGCAGATGTTTGGAGCATGGGCATACTGTTATATGTTCTTATGTGTGGATTTCTACCATTTGAT
GATGATAATGTAATGGCTTTATACAAGAAGATTATGAGAGGAAAATATGATGTTCCCAAGTGGCTCTCTC
CCAGTAGCATTCTGCTTCTTCAACAAATGCTGCAGGTGGACCCAAAGAAACGGATTTCTATGAAAAATCT
ATTGAACCATCCCTGGATCATGCAAGATTACAACTATCCTGTTGAGTGGCAAAGCAAGAATCCTTTTATT
CACCTCGATGATGATTGCGTAACAGAACTTTCTGTACATCACAGAAACAACAGGCAAACAATGGAGGATT
TAATTTCACTGTGGCAGTATGATCACCTCACGGCTACCTATCTTCTGCTTCTAGCCAAGAAGGCTCGGGG
AAAACCAGTTCGTTTAAGGCTTTCTTCTTTCTCCTGTGGACAAGCCAGTGCTACCCCATTCACAGACATC
AAGTCAAATAATTGGAGTCTGGAAGATGTGACCGCAAGTGATAAAAATTATGTGGCGGGATTAATAGACT
ATGATTGGTGTGAAGATGATTTATCAACAGGTGCTGCTACTCCCCGAACATCACAGTTTACCAAGTACTG
GACAGAATCAAATGGGGTGGAATCTAAATCATTAACTCCAGCCTTATGCAGAACACCTGCAAATAAATTA
AAGAACAAAGAAAATGTATATACTCCTAAGTCTGCTGTAAAGAATGAAGAGTACTTTATGTTTCCTGAGC
CAAAGACTCCAGTTAATAAGAACCAGCATAAGAGAGAAATACTCACTACGCCAAATCGTTACACTACACC
CTCAAAAGCTAGAAACCAGTGCCTGAAAGAAACTCCAATTAAAATACCAGTAAATTCAACAGGAACAGAC
AAGTTAATGACAGGTGTCATTAGCCCTGAGAGGCGGTGCCGCTCAGTGGAATTGGATCTCAACCAAGCAC
ATATGGAGGAGACTCCAAAAAGAAAGGGAGCCAAAGTGTTTGGGAGCCTTGAAAGGGGGTTGGATAAGGT
TATCACTGTGCTCACCAGGAGCAAAAGGAAGGGTTCTGCCAGAGACGGGCCCAGAAGACTAAAGCTTCAC
TATAATGTGACTACAACTAGATTAGTGAATCCAGATCAACTGTTGAATGAAATAATGTCTATTCTTCCAA
AGAAGCATGTTGACTTTGTACAAAAGGGTTATACACTGAAGTGTCAAACACAGTCAGATTTTGGGAAAGT
GACAATGCAATTTGAATTAGAAGTGTGCCAGCTTCAAAAACCCGATGTGGTGGGTATCAGGAGGCAGCGG
CTTAAGGGCGATGCCTGGGTTTACAAAAGATTAGTGGAAGACATCCTATCTAGCTGCAAGGTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204245 representing NM_014791
Red=Cloning site Green=Tags(s)

MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHIC
QLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLF
DEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFD
DDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFI
HLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDI
KSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTD
KLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLH
YNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQR
LKGDAWVYKRLVEDILSSCKV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_014791
ORF Size 1953 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014791.2, NP_055606
RefSeq Size 2501
RefSeq ORF 1956
Locus ID 9833
Cytogenetics 9p13.2
Domains pkinase, TyrKc, KA1, S_TKc
Protein Families Protein Kinase, Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.