ERGIC3 (NM_015966) Human Tagged ORF Clone

CAT#: RG204084

ERGIC3 (GFP-tagged) - Human ERGIC and golgi 3 (ERGIC3), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ERGIC3 (NM_015966) Human Tagged ORF Clone
Symbol ERGIC3
Synonyms C20orf47; CGI-54; dJ477O4.2; Erv46; NY-BR-84; PRO0989; SDBCAG84
Vector pCMV6-AC-GFP
Sequence Data
>RG204084 representing NM_015966
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTGGGGAAGCTGAAGCAGTTCGATGCCTACCCCAAGACTTTGGAGGACTTCCGGGTCAAGA
CCTGCGGGGGCGCCACCGTGACCATTGTCAGTGGCCTTCTCATGCTGCTACTGTTCCTGTCCGAGCTGCA
GTATTACCTCACCACGGAGGTGCATCCTGAGCTCTACGTGGACAAGTCGCGGGGAGATAAACTGAAGATC
AACATCGATGTACTTTTTCCGCACATGCCTTGTGCCTATCTGAGTATTGATGCCATGGATGTGGCCGGAG
AACAGCAGCTGGATGTGGAACACAACCTGTTCAAGCAACGACTAGATAAAGATGGCATCCCCGTGAGCTC
AGAGGCTGAGCGGCATGAGCTTGGGAAAGTCGAGGTGACGGTGTTTGACCCTGACTCCCTGGACCCTGAT
CGCTGTGAGAGCTGCTATGGTGCTGAGGCAGAAGATATCAAGTGCTGTAACACCTGTGAAGATGTGCGGG
AGGCATATCGCCGTAGAGGCTGGGCCTTCAAGAACCCAGATACTATTGAGCAGTGCCGGCGAGAGGGCTT
CAGCCAGAAGATGCAGGAGCAGAAGAATGAAGGCTGCCAGGTGTATGGCTTCTTGGAAGTCAATAAGGTG
GCCGGAAACTTCCACTTTGCCCCTGGGAAGAGCTTCCAGCAGTCCCATGTGCACGTCCATGACTTGCAGA
GCTTTGGCCTTGACAACATCAACATGACCCACTACATCCAGCACCTGTCATTTGGGGAGGACTATCCAGG
CATTGTGAACCCCCTGGACCACACCAATGTCACTGCGCCCCAAGCCTCCATGATGTTCCAGTACTTTGTG
AAGGTGGTGCCCACTGTGTACATGAAGGTGGACGGAGAGGTACTGAGGACAAATCAGTTCTCTGTGACCA
GACATGAGAAGGTTGCCAATGGGCTGTTGGGCGACCAAGGCCTTCCCGGAGTCTTCGTCCTCTATGAGCT
CTCGCCCATGATGGTGAAGCTGACGGAGAAGCACAGGTCCTTCACCCACTTCCTGACAGGTGTGTGCGCC
ATCATTGGGGGCATGTTCACAGTGGCTGGACTCATCGATTCGCTCATCTACCACTCAGCACGAGCCATCC
AGAAGAAAATTGATCTAGGGAAGACAACG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204084 representing NM_015966
Red=Cloning site Green=Tags(s)

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV
AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV
KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA
IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_015966
ORF Size 1149 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015966.2, NP_057050
RefSeq Size 1368
RefSeq ORF 1152
Locus ID 51614
Cytogenetics 20q11.22
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)