BEN Domain Containing Protein 5 (BEND5) (NM_024603) Human Tagged ORF Clone

CAT#: RG203968

Reviews ()
Write a review
  • TrueORF®

BEND5 (GFP-tagged) - Human BEN domain containing 5 (BEND5)



  "NM_024603" in other vectors (7)

USD 460.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BEN Domain Containing Protein 5 (BEND5) (NM_024603) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol BEND5
Synonyms C1orf165
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG203968 representing NM_024603
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGTCTAGAAGATGCTGTGGTGCCCCGGGCTCTGTATGAGGAGCTGCTGCGCAACTACCAGCAGC
AACAGGAAGAGATGCGCCACCTCCAGCAGGAGCTGGAGCGGACTCGGAGGCAGCTGGTACAACAGGCCAA
GAAGCTCAAGGAGTACGGGGCACTTGTGTCTGAAATGAAGGAGCTCCGTGACCTTAACCGGAGGCTCCAG
GACGTGCTGCTCCTGAGGCTTGGCAGCGGTCCCGCCATTGATCTGGAAAAAGTAAAGTCAGAATGTCTCG
AGCCCGAGCCGGAGTTACGGAGCACTTTCAGTGAGGAAGCAAATACGTCGTCCTATTACCCCGCTCCTGC
GCCTGTCATGGACAAGTATATCCTAGACAATGGCAAGGTCCATCTGGGAAGCGGGATTTGGGTTGATGAG
GAGAAATGGCACCAGCTACAAGTAACCCAAGGAGATTCCAAGTACACGAAGAACTTGGCAGTTATGATTT
GGGGAACAGATGTTCTGAAAAACAGAAGCGTCACAGGCGTCGCCACAAAAAAAAAGAAAGATGCAGTCCC
TAAACCACCCCTCTCGCCTCACAAACTAAGCATCGTCAGAGAGTGTTTGTATGACAGAATAGCACAAGAA
ACTGTGGATGAAACTGAAATTGCACAGAGACTCTCCAAAGTCAACAAGTACATCTGTGAAAAAATCATGG
ATATCAATAAATCCTGTAAAAATGAAGAACGAAGGGAAGCAAAATACAATTTGCAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203968 representing NM_024603
Red=Cloning site Green=Tags(s)

MDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQ
DVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSGIWVDE
EKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPLSPHKLSIVRECLYDRIAQE
TVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNLQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_024603
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024603.1, NP_078879.1
RefSeq Size 1781 bp
RefSeq ORF 1266 bp
Locus ID 79656
Cytogenetics 1p33

Citations (1)

Other Versions

Other products for "BEND5"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit polyclonal antibody to C1orf165 (chromosome 1 open reading frame 165)
    • 100 ul

USD 415.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools