C5R1(C5AR1) (NM_001736) Human Tagged ORF Clone

CAT#: RG203784

C5AR1 (GFP-tagged) - Human complement component 5a receptor 1 (C5AR1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C5R1(C5AR1) (NM_001736) Human Tagged ORF Clone
Symbol C5AR1
Synonyms C5A; C5AR; C5R1; CD88
Vector pCMV6-AC-GFP
Sequence Data
>RG203784 representing NM_001736
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTCCTTCAATTATACCACCCCTGATTATGGGCACTATGATGACAAGGATACCCTGGACCTCAACA
CCCCTGTGGATAAAACTTCTAACACGCTGCGTGTTCCAGACATCCTGGCCTTGGTCATCTTTGCAGTCGT
CTTCCTGGTGGGAGTGCTGGGCAATGCCCTGGTGGTCTGGGTGACGGCATTCGAGGCCAAGCGGACCATC
AATGCCATCTGGTTCCTCAACTTGGCGGTAGCCGACTTCCTCTCCTGCCTGGCGCTGCCCATCTTGTTCA
CGTCCATTGTACAGCATCACCACTGGCCCTTTGGCGGGGCCGCCTGCAGCATCCTGCCCTCCCTCATCCT
GCTCAACATGTACGCCAGCATCCTGCTCCTGGCCACCATCAGCGCCGACCGCTTTCTGCTGGTGTTTAAA
CCCATCTGGTGCCAGAACTTCCGAGGGGCCGGCTTGGCCTGGATCGCCTGTGCCGTGGCTTGGGGTTTAG
CCCTGCTGCTGACCATACCCTCCTTCCTGTACCGGGTGGTCCGGGAGGAGTACTTTCCACCAAAGGTGTT
GTGTGGCGTGGACTACAGCCACGACAAACGGCGGGAGCGAGCCGTGGCCATCGTCCGGCTGGTCCTGGGC
TTCCTGTGGCCTCTACTCACGCTCACGATTTGTTACACTTTCATCCTGCTCCGGACGTGGAGCCGCAGGG
CCACGCGGTCCACCAAGACACTCAAGGTGGTGGTGGCAGTGGTGGCCAGTTTCTTTATCTTCTGGTTGCC
CTACCAGGTGACGGGGATAATGATGTCCTTCCTGGAGCCATCGTCACCCACCTTCCTGCTGCTGAATAAG
CTGGACTCCCTGTGTGTCTCCTTTGCCTACATCAACTGCTGCATCAACCCCATCATCTACGTGGTGGCCG
GCCAGGGCTTCCAGGGCCGACTGCGGAAATCCCTCCCCAGCCTCCTCCGGAACGTGTTGACTGAAGAGTC
CGTGGTTAGGGAGAGCAAGTCATTCACGCGCTCCACAGTGGACACTATGGCCCAGAAGACCCAGGCAGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203784 representing NM_001736
Red=Cloning site Green=Tags(s)

MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI
NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK
PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG
FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK
LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001736
ORF Size 1050 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001736.3, NP_001727
RefSeq Size 2342
RefSeq ORF 1053
Locus ID 728
Cytogenetics 19q13.32
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction, Complement and coagulation cascades
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)