VPAC2(VIPR2) (NM_003382) Human Tagged ORF Clone

CAT#: RG203761

VIPR2 (GFP-tagged) - Human vasoactive intestinal peptide receptor 2 (VIPR2)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name VPAC2(VIPR2) (NM_003382) Human Tagged ORF Clone
Symbol VIPR2
Synonyms C16DUPq36.3; DUP7q36.3; PACAP-R-3; PACAP-R3; VIP-R-2; VPAC2; VPAC2R; VPCAP2R
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG203761 representing NM_003382
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGACGCTGCTGCCTCCCGCGCTGCTGACCTGCTGGCTGCTCGCCCCCGTGAACAGCATTCACCCAG
AATGCCGATTTCATCTGGAAATACAGGAGGAAGAAACAAAATGTGCAGAGCTTCTGAGGTCTCAAACAGA
AAAACACAAAGCCTGCAGTGGCGTCTGGGACAACATCACGTGCTGGCGGCCTGCCAATGTGGGAGAGACC
GTCACGGTGCCCTGCCCAAAAGTCTTCAGCAATTTTTACAGCAAAGCAGGAAACATAAGCAAAAACTGTA
CGAGTGACGGATGGTCAGAGACGTTCCCAGATTTCGTCGATGCCTGTGGCTACAGCGACCCGGAGGATGA
GAGCAAGATCACGTTTTATATTCTGGTGAAGGCCATTTATACCCTGGGCTACAGTGTCTCTCTGATGTCT
CTTGCAACAGGAAGCATAATTCTGTGCCTCTTCAGGAAGCTGCACTGCACCAGGAATTACATCCACCTGA
ACCTGTTCCTGTCCTTCATCCTGAGAGCCATCTCAGTGCTGGTCAAGGACGACGTTCTCTACTCCAGCTC
TGGCACGTTGCACTGCCCTGACCAGCCATCCTCCTGGGTGGGCTGCAAGCTGAGCCTGGTCTTCCTGCAG
TACTGCATCATGGCCAACTTCTTCTGGCTGCTGGTGGAGGGGCTCTACCTCCACACCCTCCTGGTGGCCA
TGCTCCCCCCTAGAAGGTGCTTCCTGGCCTACCTCCTGATCGGATGGGGCCTCCCCACCGTCTGCATCGG
TGCATGGACTGCGGCCAGGCTCTACTTAGAAGACACCGGTTGCTGGGATACAAACGACCACAGTGTGCCC
TGGTGGGTCATACGAATACCGATTTTAATTTCCATCATCGTCAATTTTGTCCTTTTCATTAGTATTATAC
GAATTTTGCTGCAGAAGTTAACATCCCCAGATGTCGGCGGCAACGACCAGTCTCAGTACAAGAGGCTGGC
CAAGTCCACGCTCCTGCTTATCCCGCTGTTCGGCGTCCACTACATGGTGTTTGCCGTGTTTCCCATCAGC
ATCTCCTCCAAATACCAGATACTGTTTGAGCTGTGCCTCGGGTCGTTCCAGGGCCTGGTGGTGGCCGTCC
TCTACTGTTTCCTGAACAGTGAGGTGCAGTGCGAGCTGAAGCGAAAATGGCGAAGCCGGTGCCCGACCCC
GTCCGCGAGCCGGGATTACAGGGTCTGCGGTTCCTCCTTCTCCCGCAACGGCTCGGAGGGCGCCCTGCAG
TTCCACCGCGGCTCCCGCGCCCAGTCCTTCCTGCAAACGGAGACCTCGGTCATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203761 representing NM_003382
Red=Cloning site Green=Tags(s)

MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET
VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMS
LATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQ
YCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVP
WWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS
ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ
FHRGSRAQSFLQTETSVI

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_003382
ORF Size 1314 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003382.3, NP_003373
RefSeq Size 3958
Locus ID 7434
Cytogenetics 7q36.3
Domains 7tm_2, HormR
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
Gene Summary This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. [provided by RefSeq, Aug 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.