Cofilin 1 (CFL1) (NM_005507) Human Tagged ORF Clone

CAT#: RG203585

CFL1 (GFP-tagged) - Human cofilin 1 (non-muscle) (CFL1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cofilin 1 (CFL1) (NM_005507) Human Tagged ORF Clone
Symbol CFL1
Synonyms CFL; HEL-S-15
Vector pCMV6-AC-GFP
Sequence Data
>RG203585 representing NM_005507
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCGGTGTGGCTGTCTCTGATGGTGTCATCAAGGTGTTCAACGACATGAAGGTGCGTAAGTCTT
CAACGCCAGAGGAGGTGAAGAAGCGCAAGAAGGCGGTGCTCTTCTGCCTGAGTGAGGACAAGAAGAACAT
CATCCTGGAGGAGGGCAAGGAGATCCTGGTGGGCGATGTGGGCCAGACTGTCGACGATCCCTACGCCACC
TTTGTCAAGATGCTGCCAGATAAGGACTGCCGCTATGCCCTCTATGATGCAACCTATGAGACCAAGGAGA
GCAAGAAGGAGGATCTGGTGTTTATCTTCTGGGCCCCCGAGTCTGCGCCCCTTAAGAGCAAAATGATTTA
TGCCAGCTCCAAGGACGCCATCAAGAAGAAGCTGACAGGGATCAAGCATGAATTGCAAGCAAACTGCTAC
GAGGAGGTCAAGGACCGCTGCACCCTGGCAGAGAAGCTGGGGGGCAGTGCCGTCATCTCCCTGGAGGGCA
AGCCTTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203585 representing NM_005507
Red=Cloning site Green=Tags(s)

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT
FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
EEVKDRCTLAEKLGGSAVISLEGKPL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005507
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005507.2, NP_005498
RefSeq Size 1260
RefSeq ORF 501
Locus ID 1072
Cytogenetics 11q13.1
Domains ADF
Protein Families Druggable Genome
Protein Pathways Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
Gene Summary The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)