BRMS1 (NM_015399) Human Tagged ORF Clone

CAT#: RG203428

BRMS1 (GFP-tagged) - Human breast cancer metastasis suppressor 1 (BRMS1), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name BRMS1 (NM_015399) Human Tagged ORF Clone
Symbol BRMS1
Synonyms DKFZp564A063
Vector pCMV6-AC-GFP
Sequence Data
>RG203428 representing NM_015399
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGTCCAGCCTCCAAGCAAAGACACAGAAGAGATGGAAGCAGAGGGTGATTCTGCTGCTGAGATGA
ATGGGGAGGAGGAAGAGAGTGAGGAGGAGCGGAGCGGCAGCCAGACAGAGTCAGAAGAGGAGAGCTCCGA
GATGGATGATGAGGACTATGAGCGACGCCGCAGCGAGTGTGTCAGTGAGATGCTGGACCTAGAGAAGCAG
TTCTCGGAGCTAAAGGAGAAGTTGTTCAGGGAACGACTGAGTCAGCTGCGGTTGCGGCTGGAGGAAGTGG
GGGCTGAGAGAGCCCCTGAATACACGGAGCCCCTTGGGGGGCTGCAGCGGAGCCTCAAGATTCGCATTCA
GGTGGCAGGGATCTACAAGGGCTTCTGTCTGGATGTGATCAGGAATAAGTACGAATGTGAGCTGCAGGGA
GCCAAACAGCACCTGGAGAGTGAGAAGCTGCTGCTCTATGACACGCTGCAGGGGGAGCTGCAGGAGCGGA
TCCAGAGGCTGGAGGAGGACCGCCAGAGCCTGGATCTCAGCTCTGAATGGTGGGACGACAAACTGCACGC
CAGAGGCAGCTCCAGGTCTTGGGACTCCCTGCCGCCCAGCAAGAGGAAGAAGGCACCTCTGGTTTCTGGC
CCATACATCGTGTACATGCTTCAAGAGATCGACATCCTGGAGGACTGGACAGCCATCAAAAAGGCTAGGG
CAGCTGTGTCCCCTCAGAAGAGAAAATCGGATGGACCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203428 representing NM_015399
Red=Cloning site Green=Tags(s)

MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ
FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG
AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG
PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_015399
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015399.3, NP_056214
RefSeq Size 1455
RefSeq ORF 741
Locus ID 25855
Cytogenetics 11q13.2
Protein Families Druggable Genome
Gene Summary This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)