Annexin IV (ANXA4) (NM_001153) Human Tagged ORF Clone

CAT#: RG203229

Reviews ()
Write a review
  • TrueORF®

ANXA4 (GFP-tagged) - Human annexin A4 (ANXA4)



  "NM_001153" in other vectors (4)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Annexin IV (ANXA4) (NM_001153) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ANXA4
Synonyms ANX4; HEL-S-274; P32.5; PAP-II; PIG28; PP4-X; ZAP36
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG203229 representing NM_001153
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGGCAACCAAAGGAGGTACTGTCAAAGCTGCTTCAGGATTCAATGCCATGGAAGATGCCCAGA
CCCTGAGGAAGGCCATGAAAGGGCTCGGCACCGATGAAGACGCCATTATTAGCGTCCTTGCCTACCGCAA
CACCGCCCAGCGCCAGGAGATCAGGACAGCCTACAAGAGCACCATCGGCAGGGACTTGATAGACGACCTG
AAGTCAGAACTGAGTGGCAACTTCGAGCAGGTGATTGTGGGGATGATGACGCCCACGGTGCTGTATGACG
TGCAAGAGCTGCGAAGGGCCATGAAGGGAGCCGGCACTGATGAGGGCTGCCTAATTGAGATCCTGGCCTC
CCGGACCCCTGAGGAGATCCGGCGCATAAGCCAAACCTACCAGCAGCAATATGGACGGAGCCTTGAAGAT
GACATTCGCTCTGACACATCGTTCATGTTCCAGCGAGTGCTGGTGTCTCTGTCAGCTGGTGGGAGGGATG
AAGGAAATTATCTGGACGATGCTCTCGTGAGACAGGATGCCCAGGACCTGTATGAGGCTGGAGAGAAGAA
ATGGGGGACAGATGAGGTGAAATTTCTAACTGTTCTCTGTTCCCGGAACCGAAATCACCTGTTGCATGTG
TTTGATGAATACAAAAGGATATCACAGAAGGATATTGAACAGAGTATTAAATCTGAAACATCTGGTAGCT
TTGAAGATGCTCTGCTGGCTATAGTAAAGTGCATGAGGAACAAATCTGCATATTTTGCTGAAAAGCTCTA
TAAATCGATGAAGGGCTTGGGCACCGATGATAACACCCTCATCAGAGTGATGGTTTCTCGAGCAGAAATT
GACATGTTGGATATCCGGGCACACTTCAAGAGACTCTATGGAAAGTCTCTGTACTCGTTCATCAAGGGTG
ACACATCTGGAGACTACAGGAAAGTACTGCTTGTTCTCTGTGGAGGAGATGAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203229 representing NM_001153
Red=Cloning site Green=Tags(s)

MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDL
KSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLED
DIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHV
FDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEI
DMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001153
ORF Size 963 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001153.2, NP_001144.1
RefSeq Size 1982 bp
RefSeq ORF 966 bp
Locus ID 307
Cytogenetics 2p13.3
Domains annexin
Gene Summary Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2016]

Citations (2)

Other Versions

Other products for "ANXA4"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal Anti-ANXA4 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools