Iba1 (AIF1) (NM_032955) Human Tagged ORF Clone

CAT#: RG203154

  • TrueORF®

AIF1 (tGFP-tagged) - Human allograft inflammatory factor 1 (AIF1), transcript variant 1



  "NM_032955" in other vectors (6)

Reconstitution Protocol

USD 365.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "AIF1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AIF1
Synonyms AIF-1; IBA1; IRT-1; IRT1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203154 representing NM_032955
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCAAACCAGGGATTTACAGGGAGGAAAAGCTTTCGGACTGCTGAAGGCCCAGCAGGAAGAGAGGC
TGGATGAGATCAACAAGCAATTCCTAGACGATCCCAAATATAGCAGTGATGAGGATCTGCCCTCCAAACT
GGAAGGCTTCAAAGAGAAATACATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTG
AAACGAATGCTGGAGAAACTTGGAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGT
CCAGTGGCTCCGGGGAGACGTTCAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCAT
CCTAAAAATGATCCTGATGTATGAGGAAAAAGCGAGAGAAAAGGAAAAGCCAACAGGCCCCCCAGCCAAG
AAAGCTATCTCTGAGTTGCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203154 representing NM_032955
Red=Cloning site Green=Tags(s)

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSL
KRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAK
KAISELP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032955
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032955.1, NP_116573.1
RefSeq Size 503 bp
RefSeq ORF 282 bp
Locus ID 199
UniProt ID P55008
Cytogenetics 6p21.33
Protein Families Druggable Genome
Gene Summary This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.