IP10(CXCL10) (NM_001565) Human Tagged ORF Clone

CAT#: RG203141

CXCL10 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 10 (CXCL10)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name IP10(CXCL10) (NM_001565) Human Tagged ORF Clone
Symbol CXCL10
Synonyms C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10
Vector pCMV6-AC-GFP
Sequence Data
>RG203141 representing NM_001565
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAAGGAGTACCTC
TCTCTAGAACTGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTTAATCCAAGGTCTTTAGAAAA
ACTTGAAATTATTCCTGCAAGCCAATTTTGTCCACGTGTTGAGATCATTGCTACAATGAAAAAGAAGGGT
GAGAAGAGATGTCTGAATCCAGAATCGAAGGCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGT
CTAAAAGATCTCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203141 representing NM_001565
Red=Cloning site Green=Tags(s)

MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG
EKRCLNPESKAIKNLLKAVSKERSKRSP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001565
ORF Size 294 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001565.1, NP_001556
RefSeq Size 1172
RefSeq ORF 297
Locus ID 3627
Cytogenetics 4q21.1
Domains IL8
Protein Families Secreted Protein, Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Chemokine signaling pathway, Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway
Gene Summary Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)