BAG3 (NM_004281) Human Tagged ORF Clone

CAT#: RG202860

Reviews ()
Write a review
  • TrueORF®

BAG3 (GFP-tagged) - Human BCL2-associated athanogene 3 (BAG3)



  "NM_004281" in other vectors (7)

USD 530.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BAG3 (NM_004281) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol BAG3
Synonyms BAG-3; BIS; CAIR-1; MFM6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG202860 representing NM_004281
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGCCGCCACCCACTCGCCCATGATGCAGGTGGCGTCCGGCAACGGTGACCGCGACCCTTTGCCCC
CCGGATGGGAGATCAAGATCGACCCGCAGACCGGCTGGCCCTTCTTCGTGGACCACAACAGCCGCACCAC
TACGTGGAACGACCCGCGCGTGCCCTCTGAGGGCCCCAAGGAGACTCCATCCTCTGCCAATGGCCCTTCC
CGGGAGGGCTCTAGGCTGCCGCCTGCTAGGGAAGGCCACCCTGTGTACCCCCAGCTCCGACCAGGCTACA
TTCCCATTCCTGTGCTCCATGAAGGCGCTGAGAACCGGCAGGTGCACCCTTTCCATGTCTATCCCCAGCC
TGGGATGCAGCGATTCCGAACTGAGGCGGCAGCAGCGGCTCCTCAGAGGTCCCAGTCACCTCTGCGGGGC
ATGCCAGAAACCACTCAGCCAGATAAACAGTGTGGACAGGTGGCAGCGGCGGCGGCAGCCCAGCCCCCAG
CCTCCCACGGACCTGAGCGGTCCCAGTCTCCAGCTGCCTCTGACTGCTCATCCTCATCCTCCTCGGCCAG
CCTGCCTTCCTCCGGCAGGAGCAGCCTGGGCAGTCACCAGCTCCCGCGGGGGTACATCTCCATTCCGGTG
ATACACGAGCAGAACGTTACCCGGCCAGCAGCCCAGCCCTCCTTCCACCAAGCCCAGAAGACGCACTACC
CAGCGCAGCAGGGGGAGTACCAGACCCACCAGCCTGTGTACCACAAGATCCAGGGGGATGACTGGGAGCC
CCGGCCCCTGCGGGCGGCATCCCCGTTCAGGTCATCTGTCCAGGGTGCATCGAGCCGGGAGGGCTCACCA
GCCAGGAGCAGCACGCCACTCCACTCCCCCTCGCCCATCCGTGTGCACACCGTGGTCGACAGGCCTCAGC
AGCCCATGACCCATCGAGAAACTGCACCTGTTTCCCAGCCTGAAAACAAACCAGAAAGTAAGCCAGGCCC
AGTTGGACCAGAACTCCCTCCTGGACACATCCCAATTCAAGTGATCCGCAAAGAGGTGGATTCTAAACCT
GTTTCCCAGAAGCCCCCACCTCCCTCTGAGAAGGTAGAGGTGAAAGTTCCCCCTGCTCCAGTTCCTTGTC
CTCCTCCCAGCCCTGGCCCTTCTGCTGTCCCCTCTTCCCCCAAGAGTGTGGCTACAGAAGAGAGGGCAGC
CCCCAGCACTGCCCCTGCAGAAGCTACACCTCCAAAACCAGGAGAAGCCGAGGCTCCCCCAAAACATCCA
GGAGTGCTGAAAGTGGAAGCCATCCTGGAGAAGGTACAGGGGCTGGAGCAGGCTGTAGACAACTTTGAAG
GCAAGAAGACTGACAAAAAGTACCTGATGATCGAAGAGTATTTGACCAAAGAGCTGCTGGCCCTGGATTC
AGTGGACCCCGAGGGACGAGCCGATGTGCGTCAGGCCAGGAGAGACGGTGTCAGGAAGGTTCAGACCATC
TTGGAAAAACTTGAACAGAAAGCCATTGATGTCCCAGGTCAAGTCCAGGTCTATGAACTCCAGCCCAGCA
ACCTTGAAGCAGATCAGCCACTGCAGGCAATCATGGAGATGGGTGCCGTGGCAGCAGACAAGGGCAAGAA
AAATGCTGGAAATGCAGAAGATCCCCACACAGAAACCCAGCAGCCAGAAGCCACAGCAGCAGCGACTTCA
AACCCCAGCAGCATGACAGACACCCCTGGTAACCCAGCAGCACCG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202860 representing NM_004281
Red=Cloning site Green=Tags(s)

MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPS
REGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRG
MPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPV
IHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSP
ARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKP
VSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTI
LEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATS
NPSSMTDTPGNPAAP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004281
ORF Size 1725 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004281.3, NP_004272.2
RefSeq Size 2608 bp
RefSeq ORF 1728 bp
Locus ID 9531
Cytogenetics 10q26.11
Domains WW, BAG
Protein Families Druggable Genome
Gene Summary BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "BAG3"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit polyclonal anti-BAG3 antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools