ARHI(DIRAS3) (NM_004675) Human Tagged ORF Clone

CAT#: RG202787

DIRAS3 (GFP-tagged) - Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ARHI(DIRAS3) (NM_004675) Human Tagged ORF Clone
Symbol DIRAS3
Synonyms ARHI; NOEY2
Vector pCMV6-AC-GFP
Sequence Data
>RG202787 representing NM_004675
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTAACGCCAGCTTTGGCTCCAAGGAACAGAAGCTGCTGAAGCGGTTGCGGCTTCTGCCCGCCCTGC
TTATCCTCCGCGCCTTCAAGCCCCACAGGAAGATCAGAGATTACCGCGTCGTGGTAGTCGGCACCGCTGG
TGTGGGGAAAAGTACGCTGCTGCACAAGTGGGCGAGCGGCAACTTCCGTCATGAGTACCTGCCGACCATT
GAAAATACCTACTGCCAGTTGCTGGGCTGCAGCCACGGTGTGCTTTCCCTGCACATCACCGACAGCAAGA
GTGGCGACGGCAACCGCGCTCTGCAGCGCCACGTTATAGCCCGGGGCCACGCCTTCGTCCTGGTCTACTC
AGTCACCAAGAAGGAAACCCTGGAAGAGCTGAAGGCCTTCTATGAGCTGATCTGCAAGATCAAAGGTAAC
AACCTGCATAAGTTCCCCATCGTGCTGGTGGGCAATAAAAGTGATGACACCCACCGGGAGGTGGCCCTGA
ATGATGGTGCCACCTGTGCGATGGAGTGGAATTGCGCCTTCATGGAGATTTCAGCCAAGACCGATGTGAA
TGTGCAGGAGCTGTTCCACATGCTGCTGAATTACAAGAAAAAGCCCACCACCGGCCTCCAGGAGCCCGAG
AAGAAATCCCAGATGCCCAACACCACTGAGAAGCTGCTTGACAAGTGCATAATCATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202787 representing NM_004675
Red=Cloning site Green=Tags(s)

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
KKSQMPNTTEKLLDKCIIM

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004675
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004675.2, NP_004666
RefSeq Size 1642
RefSeq ORF 690
Locus ID 9077
Cytogenetics 1p31.3
Gene Summary This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)