HLA-DRB4 (NM_021983) Human Tagged ORF Clone

CAT#: RG202743

HLA (GFP-tagged) - Human major histocompatibility complex, class II, DR beta 4 (HLA-DRB4)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HLA-DRB4 (NM_021983) Human Tagged ORF Clone
Symbol HLA-DRB4
Synonyms DR4; DRB4; HLA-DR4B
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG202743 representing NM_021983
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGTATGGCAGCGCTGACAGTGACATTGACGGTGCTGAGCT
CCCCACTGGCTTTGGCTGGGGACACCCAACCACGTTTCTTGGAGCAGGCTAAGTGTGAGTGTCATTTCCT
CAATGGGACGGAGCGAGTGTGGAACCTGATCAGATACATCTATAACCAAGAGGAGTACGCGCGCTACAAC
AGTGACCTGGGGGAGTACCAGGCGGTGACGGAGCTGGGGCGGCCTGACGCTGAGTACTGGAACAGCCAGA
AGGACCTCCTGGAGCGGAGGCGGGCCGAGGTGGACACCTACTGCAGATACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAATGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACG
GCCAGGAAGAGAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCTTCCAGACCCT
GGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCATCCAAGCATGATG
AGCCCTCTCACGGTGCAATGGAGTGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGACAGGGCTGTTCATCTACTTCAGGAATCAGAAAGGACACTC
TGGACTTCAGCCAACAGGACTCTTGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202743 representing NM_021983
Red=Cloning site Green=Tags(s)

MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYN
SDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQH
HNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMM
SPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_021983
ORF Size 798 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021983.4, NP_068818
RefSeq Size 1193
RefSeq ORF 801
Locus ID 3126
Cytogenetics 6p21.3
Domains MHC_II_beta, ig, IGc1
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Antigen processing and presentation, Hematopoietic cell lineage, Type I diabetes mellitus, Asthma, Autoimmune thyroid disease, Systemic lupus erythematosus, Allograft rejection, Graft-versus-host disease, Viral myocarditis
Gene Summary HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations