CRMP5(DPYSL5) (NM_020134) Human Tagged ORF Clone

CAT#: RG202631

DPYSL5 (GFP-tagged) - Human dihydropyrimidinase-like 5 (DPYSL5)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 794.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CRMP5(DPYSL5) (NM_020134) Human Tagged ORF Clone
Symbol DPYSL5
Synonyms CRAM; CRMP-5; CRMP5; Ulip6
Vector pCMV6-AC-GFP
Sequence Data
>RG202631 representing NM_020134
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTGCCAACTCAGCCAGCGTGAGGATCCTCATCAAGGGAGGCAAGGTGGTGAACGATGACTGCACCC
ACGAGGCTGACGTCTACATCGAGAATGGCATCATCCAGCAGGTGGGCCGCGAGCTCATGATCCCTGGCGG
GGCCAAGGTGATTGATGCCACAGGAAAACTGGTGATCCCTGGTGGCATCGACACCAGCACCCACTTCCAC
CAGACCTTCATGAATGCCACGTGCGTGGACGACTTCTACCATGGGACCAAGGCAGCACTCGTCGGAGGCA
CCACCATGATCATCGGCCACGTCCTGCCCGACAAGGAGACCTCCCTTGTGGACGCTTATGAGAAGTGCCG
AGGTCTGGCCGACCCCAAGGTCTGCTGTGATTACGCCCTCCACGTGGGGATCACCTGGTGGGCACCCAAG
GTGAAAGCAGAAATGGAGACACTGGTGAGGGAGAAGGGTGTCAACTCGTTCCAGATGTTCATGACCTACA
AGGACCTGTACATGCTTCGAGACAGTGAGCTGTACCAAGTGTTGCACGCTTGCAAGGACATTGGGGCAAT
CGCCCGCGTCCATGCTGAAAATGGGGAGCTTGTGGCCGAGGGTGCTAAGGAGGCACTGGATTTGGGGATC
ACAGGCCCAGAAGGAATCGAGATCAGCCGTCCAGAGGAGCTGGAAGCTGAAGCCACTCATCGTGTTATCA
CCATTGCAAACAGGACTCACTGTCCAATCTACCTGGTCAACGTGTCCAGTATCTCGGCTGGTGACGTTAT
CGCAGCTGCTAAGATGCAAGGGAAGGTTGTGCTGGCGGAGACCACCACTGCACATGCCACGCTGACAGGC
TTACACTACTACCACCAGGACTGGTCCCACGCGGCTGCCTATGTCACGGTGCCTCCCCTGAGACTGGACA
CCAACACCTCAACCTACCTCATGAGCCTGCTGGCCAATGACACTCTGAACATCGTGGCATCAGATCACCG
GCCTTTCACCACAAAGCAGAAAGCTATGGGCAAGGAAGACTTCACCAAGATCCCACATGGAGTGAGTGGC
GTGCAGGACCGCATGAGCGTCATCTGGGAGAGAGGAGTGGTTGGAGGAAAGATGGATGAGAACCGTTTTG
TGGCCGTTACCAGTTCCAACGCAGCTAAGCTTCTGAACCTGTATCCCCGCAAGGGCCGCATTATTCCCGG
AGCCGATGCTGATGTGGTGGTGTGGGACCCAGAAGCCACAAAGACCATCTCAGCCAGCACGCAGGTCCAG
GGAGGAGACTTCAACCTGTATGAGAACATGCGCTGCCACGGCGTGCCACTGGTCACCATCAGCCGGGGGC
GCGTCGTGTATGAGAACGGCGTCTTCATGTGCGCCGAGGGCACCGGCAAGTTCTGTCCCCTGAGGTCCTT
CCCAGACACTGTCTACAAGAAGCTGGTCCAGAGAGAGAAGACTTTAAAGGTTAGAGGAGTGGACCGCACT
CCCTACCTGGGGGATGTCGCTGTTGTCGTGCACCCTGGGAAAAAAGAGATGGGAACCCCACTCGCAGACA
CTCCTACCCGGCCCGTCACCCGGCATGGGGGCATGAGGGACCTTCACGAATCCAGCTTCAGCCTCTCTGG
CTCTCAGATCGATGACCATGTTCCAAAGCGAGCTTCAGCTCGGATCCTCGCTCCTCCCGGAGGCAGGTCG
AGTGGCATTTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202631 representing NM_020134
Red=Cloning site Green=Tags(s)

MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFH
QTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPK
VKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGI
TGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTG
LHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSG
VQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ
GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRT
PYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS
SGIW

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020134
ORF Size 1692 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020134.2, NP_064519
RefSeq Size 3074
RefSeq ORF 1695
Locus ID 56896
Cytogenetics 2p23.3
Domains Amidohydro_1
Protein Pathways Axon guidance
Gene Summary This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)