FOXA3 (NM_004497) Human Tagged ORF Clone

CAT#: RG202363

FOXA3 (GFP-tagged) - Human forkhead box A3 (FOXA3)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXA3 (NM_004497) Human Tagged ORF Clone
Symbol FOXA3
Synonyms FKHH3; HNF3G; TCF3G
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG202363 representing NM_004497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGCTCAGTGAAGATGGAGGCCCATGACCTGGCCGAGTGGAGCTACTACCCGGAGGCGGGCGAGG
TCTACTCGCCGGTGACCCCAGTGCCCACCATGGCCCCCCTCAACTCCTACATGACCCTGAATCCTCTAAG
CTCTCCCTATCCCCCTGGGGGGCTCCCTGCCTCCCCACTGCCCTCAGGACCCCTGGCACCCCCAGCACCT
GCAGCCCCCCTGGGGCCCACTTTCCCAGGCCTGGGTGTCAGCGGTGGCAGCAGCAGCTCCGGGTACGGGG
CCCCGGGTCCTGGGCTGGTGCACGGGAAGGAGATGCCGAAGGGGTATCGGCGGCCCCTGGCACACGCCAA
GCCACCGTATTCCTATATCTCACTCATCACCATGGCCATCCAGCAGGCGCCGGGCAAGATGCTGACCTTG
AGTGAAATCTACCAGTGGATCATGGACCTCTTCCCTTACTACCGGGAGAATCAGCAGCGCTGGCAGAACT
CCATTCGCCACTCGCTGTCTTTCAACGACTGCTTCGTCAAGGTGGCGCGTTCCCCAGACAAGCCTGGCAA
GGGCTCCTACTGGGCCCTACACCCCAGCTCAGGGAACATGTTTGAGAATGGCTGCTACCTGCGCCGCCAG
AAACGCTTCAAGCTGGAGGAGAAGGTGAAAAAAGGGGGCAGCGGGGCTGCCACCACCACCAGGAACGGGA
CAGGGTCTGCTGCCTCGACCACCACCCCCGCGGCCACAGTCACCTCCCCGCCCCAGCCCCCGCCTCCAGC
CCCTGAGCCTGAGGCCCAGGGCGGGGAAGATGTGGGGGCTCTGGACTGTGGCTCACCCGCTTCCTCCACA
CCCTATTTCACTGGCCTGGAGCTCCCAGGGGAGCTGAAGCTGGACGCGCCCTACAACTTCAACCACCCTT
TCTCCATCAACAACCTAATGTCAGAACAGACACCAGCACCTCCCAAACTGGACGTGGGGTTTGGGGGCTA
CGGGGCTGAAGGTGGGGAGCCTGGAGTCTACTACCAGGGCCTCTATTCCCGCTCTTTGCTTAATGCATCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202363 representing NM_004497
Red=Cloning site Green=Tags(s)

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAP
AAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTL
SEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQ
KRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASST
PYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004497
ORF Size 1050 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004497.2, NP_004488
RefSeq Size 2046
RefSeq ORF 1053
Locus ID 3171
Cytogenetics 19q13.32
Protein Families ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
Gene Summary This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations