ARHGEF19 (NM_153213) Human Tagged ORF Clone

CAT#: RG202273

ARHGEF19 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 19 (ARHGEF19)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARHGEF19 (NM_153213) Human Tagged ORF Clone
Symbol ARHGEF19
Synonyms WGEF; WGEF
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG202273 representing NM_153213
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTGTGGGCCACCTGCTACCCTCCAGCCCCACCTGACTGGGCCACCTGGCACTGCCCACCACCCTG
TAGCAGTGTGCCAGCAGGAGAGTCTGTCCTTTGCAGAGCTGCCCGCCCTGAAGCCCCCGAGCCCAGTGTG
TCTGGACCTTTTCCCTGTTGCCCCAGAGGAGCTTCGGGCTCCTGGCAGCCGCTGGTCCCTGGGGACCCCT
GCCCCTCTCCAAGGGTTGCTATGGCCATTATCCCCAGGAGGCTCAGATACAGAGATCACCAGCGGGGGGA
TGCGGCCCAGCAGGGCTGGCAGCTGGCCACACTGTCCTGGTGCCCAGCCCCCAGCTCTGGAGGGACCCTG
GAGTCCCCGACACACACAGCCACAGCGCCGGGCCAGCCACGGCTCGGAGAAGAAGTCTGCCTGGCGCAAG
ATGCGGGTGTACCAGCGTGAAGAGGTCCCCGGCTGCCCCGAGGCCCACGCTGTCTTCCTAGAGCCTGGCC
AGGTAGTGCAAGAGCAGGCCCTGAGCACAGAGGAGCCCAGGGTGGAGTTGTCTGGGTCCACCCGAGTGAG
CCTCGAAGGTCCTGAGCGGAGGCGCTTCTCGGCATCGGAGCTGATGACCCGGCTGCACTCTTCTCTGCGC
CTGGGGCGGAATTCAGCAGCCCGGGCACTCATCTCTGGGTCAGGCACCGGAGCAGCCCGGGAAGGGAAAG
CATCTGGAATGGAGGCTCGAAGTGTAGAGATGAGCGGGGACCGGGTGTCGCGGCCAGCCCCTGGTGACTC
ACGAGAGGGCGATTGGTCCGAGCCCAGGCTAGACACACAGGAAGAGCCGCCTTTGGGGTCCAGGAGCACC
AACGAGCGGCGCCAGTCTCGATTCCTCCTTAACTCCGTCCTCTATCAGGAATACAGCGACGTGGCCAGCG
CCCGCGAACTGCGGCGGCAGCAGCGCGAGGAGGAGGGCCCGGGGGACGAGGCCGAGGGCGCAGAGGAGGG
GCCGGGGCCGCCGCGGGCCAACCTCTCCCCCAGCAGCTCCTTCCGGGCGCAGCGCTCGGCGCGAGGCTCC
ACCTTCTCGCTGTGGCAGGATATCCCCGACGTACGCGGCAGCGGCGTCCTGGCCACGCTGAGCCTGCGGG
ACTGCAAGCTGCAGGAGGCCAAGTTTGAGCTGATCACCTCCGAGGCCTCCTACATCCACAGCCTGTCGGT
GGCTGTGGGCCACTTCTTAGGCTCTGCCGAGCTGAGCGAGTGTCTGGGGGCGCAGGACAAGCAGTGGCTG
TTTTCCAAACTGCCCGAGGTCAAGAGCACCAGCGAGAGGTTCCTGCAGGACCTGGAGCAGCGGCTGGAGG
CAGATGTGCTGCGCTTCAGCGTGTGCGACGTGGTGCTGGACCACTGCCCGGCCTTCCGCAGAGTCTACCT
GCCCTATGTCACCAACCAGGCCTACCAGGAGCGCACCTACCAGCGCCTGCTCCTGGAGAACCCCAGGTTC
CCTGGCATCCTGGCTCGCCTGGAGGAGTCTCCTGTGTGCCAGCGTCTGCCCCTTACCTCCTTCCTTATCC
TGCCCTTCCAGAGGATCACCCGCCTCAAGATGTTGGTGGAGAACATCCTGAAGCGGACAGCACAGGGCTC
TGAAGACGAAGACATGGCCACCAAGGCCTTCAATGCGCTCAAGGAGCTGGTGCAGGAGTGCAATGCTAGT
GTACAGTCCATGAAGAGGACAGAGGAACTCATCCACCTGAGCAAGAAGATCCACTTTGAGGGCAAGATTT
TCCCGCTGATCTCTCAGGCCCGCTGGCTGGTTCGGCATGGAGAGTTGGTAGAGCTGGCACCACTGCCTGC
AGCACCCCCTGCCAAGCTGAAGCTGTCCAGCAAGGCAGTCTACCTCCACCTCTTCAATGACTGCTTGCTG
CTCTCTCGGCGGAAGGAGCTAGGGAAGTTTGCCGTTTTCGTCCATGCCAAGATGGCTGAGCTGCAGGTGC
GGGACCTGAGCCTGAAGCTGCAGGGCATCCCCGGCCACGTGTTCCTCCTCCAGCTCCTCCACGGGCAGCA
CATGAAGCACCAGTTCCTGCTGCGGGCCCGGACGGAAAGTGAGAAGCAGCGATGGATCTCAGCCTTGTGC
CCCTCCAGCCCCCAGGAGGACAAGGAGGTCATCAGTGAGGGGGAAGATTGCCCCCAGGTTCAGTGTGTTA
GGACATACAAGGCACTGCACCCAGATGAGCTGACCTTGGAGAAGACTGACATCCTGTCAGTGAGGACCTG
GACCAGTGACGGCTGGCTGGAAGGGGTCCGCCTGGCAGATGGTGAGAAGGGGTGGGTGCCCCAGGCCTAT
GTGGAAGAGATCAGCAGCCTCAGCGCCCGCCTCCGAAACCTCCGGGAGAATAAGCGAGTCACAAGTGCCA
CCAGCAAACTGGGGGAGGCTCCTGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202273 representing NM_153213
Red=Cloning site Green=Tags(s)

MDCGPPATLQPHLTGPPGTAHHPVAVCQQESLSFAELPALKPPSPVCLDLFPVAPEELRAPGSRWSLGTP
APLQGLLWPLSPGGSDTEITSGGMRPSRAGSWPHCPGAQPPALEGPWSPRHTQPQRRASHGSEKKSAWRK
MRVYQREEVPGCPEAHAVFLEPGQVVQEQALSTEEPRVELSGSTRVSLEGPERRRFSASELMTRLHSSLR
LGRNSAARALISGSGTGAAREGKASGMEARSVEMSGDRVSRPAPGDSREGDWSEPRLDTQEEPPLGSRST
NERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGS
TFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQDKQWL
FSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERTYQRLLLENPRF
PGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMATKAFNALKELVQECNAS
VQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLL
LSRRKELGKFAVFVHAKMAELQVRDLSLKLQGIPGHVFLLQLLHGQHMKHQFLLRARTESEKQRWISALC
PSSPQEDKEVISEGEDCPQVQCVRTYKALHPDELTLEKTDILSVRTWTSDGWLEGVRLADGEKGWVPQAY
VEEISSLSARLRNLRENKRVTSATSKLGEAPV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_153213
ORF Size 2406 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_153213.2, NP_694945
RefSeq Size 3045
RefSeq ORF 2409
Locus ID 128272
Cytogenetics 1p36.13
Gene Summary Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases (see RHOA, MIM 165390).[supplied by OMIM, Dec 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)