ID1 (NM_002165) Human Tagged ORF Clone

CAT#: RG202061

ID1 (GFP-tagged) - Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ID1 (NM_002165) Human Tagged ORF Clone
Symbol ID1
Synonyms bHLHb24; ID
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG202061 representing NM_002165
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGTCGCCAGTGGCAGCACCGCCACCGCCGCCGCGGGCCCCAGCTGCGCGCTGAAGGCCGGCAAGA
CAGCGAGCGGTGCGGGCGAGGTGGTGCGCTGTCTGTCTGAGCAGAGCGTGGCCATCTCGCGCTGCGCCGG
GGGCGCCGGGGCGCGCCTGCCTGCCCTGCTGGACGAGCAGCAGGTAAACGTGCTGCTCTACGACATGAAC
GGCTGTTACTCACGCCTCAAGGAGCTGGTGCCCACCCTGCCCCAGAACCGCAAGGTGAGCAAGGTGGAGA
TTCTCCAGCACGTCATCGACTACATCAGGGACCTTCAGTTGGAGCTGAACTCGGAATCCGAAGTTGGAAC
CCCCGGGGGCCGAGGGCTGCCGGTCCGGGCTCCGCTCAGCACCCTCAACGGCGAGATCAGCGCCCTGACG
GCCGAGGCGGCATGCGTTCCTGCGGACGATCGCATCTTGTGTCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202061 representing NM_002165
Red=Cloning site Green=Tags(s)

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN
GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT
AEAACVPADDRILCR

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002165
ORF Size 465 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002165.2, NP_002156
RefSeq Size 993
RefSeq ORF 468
Locus ID 3397
Cytogenetics 20q11.21
Domains HLH
Protein Families Transcription Factors, Druggable Genome
Protein Pathways TGF-beta signaling pathway
Gene Summary The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.