DPAGT1 (NM_001382) Human Tagged ORF Clone

CAT#: RG201787

DPAGT1 (GFP-tagged) - Human dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) (DPAGT1)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DPAGT1 (NM_001382) Human Tagged ORF Clone
Symbol DPAGT1
Synonyms ALG7; CDG-Ij; CDG1J; CMSTA2; D11S366; DGPT; DPAGT; DPAGT2; G1PT; GPT; UAGT; UGAT
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG201787 representing NM_001382
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGCCTTCTCGGAATTGCCCATGCCGCTGCTGATCAATTTGATCGTCTCGCTGCTGGGATTTGTGG
CCACAGTCACCCTCATCCCGGCCTTCCGGGGCCACTTCATTGCTGCGCGCCTCTGTGGTCAGGACCTCAA
CAAAACCAGCCGACAGCAGATCCCAGAATCCCAGGGAGTGATCAGCGGTGCTGTTTTCCTTATCATCCTC
TTCTGCTTCATCCCTTTCCCCTTCCTGAACTGCTTTGTGAAGGAGCAGTGTAAGGCATTCCCCCACCATG
AATTTGTGGCCCTGATAGGTGCCCTCCTTGCCATCTGCTGCATGATCTTCCTGGGCTTTGCGGATGATGT
ACTGAATCTGCGCTGGCGCCATAAGCTGCTGCTACCTACAGCTGCCTCACTACCTCTCCTCATGGTCTAT
TTCACCAACTTTGGCAACACGACCATTGTGGTGCCCAAGCCCTTCCGCCCGATACTTGGCCTGCATCTGG
ACTTGGGAATCCTGTACTATGTCTACATGGGGCTGCTGGCAGTGTTCTGTACCAATGCCATCAATATCCT
AGCAGGAATTAACGGCCTAGAGGCTGGCCAGTCACTAGTCATTTCTGCTTCCATCATTGTCTTCAACCTG
GTAGAGTTGGAAGGTGATTGTCGGGATGATCATGTCTTTTCCCTCTACTTCATGATACCCTTTTTTTTCA
CCACTTTGGGATTGCTCTACCACAACTGGTACCCATCACGGGTGTTTGTGGGAGATACCTTCTGTTACTT
TGCTGGCATGACCTTTGCCGTGGTGGGCATCTTGGGACACTTCAGCAAGACCATGCTACTATTCTTCATG
CCCCAGGTGTTCAACTTCCTCTACTCACTGCCTCAGCTCCTGCATATCATCCCCTGCCCTCGCCACCGCA
TACCCAGACTCAATATCAAGACAGGCAAACTGGAGATGAGCTATTCCAAGTTCAAGACCAAGAGCCTCTC
TTTCTTGGGCACCTTTATTTTAAAGGTGGCAGAGAGCCTCCAGCTGGTGACAGTACACCAGAGTGAGACT
GAAGATGGTGAATTCACTGAATGTAACAACATGACCCTCATCAACTTGCTACTTAAAGTCCTTGGGCCCA
TACATGAGAGAAACCTCACATTGCTCCTGCTGCTGCTGCAGATCCTGGGCAGTGCCATCACCTTCTCCAT
TCGATATCAGCTCGTTCGACTCTTCTATGATGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201787 representing NM_001382
Red=Cloning site Green=Tags(s)

MWAFSELPMPLLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGVISGAVFLIIL
FCFIPFPFLNCFVKEQCKAFPHHEFVALIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVY
FTNFGNTTIVVPKPFRPILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNL
VELEGDCRDDHVFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFM
PQVFNFLYSLPQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSET
EDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLVRLFYDV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001382
ORF Size 1224 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001382.2, NP_001373
RefSeq Size 2159
RefSeq ORF 1227
Locus ID 1798
Cytogenetics 11q23.3
Domains Glycos_transf_4
Protein Families Transmembrane
Protein Pathways N-Glycan biosynthesis, Metabolic pathways
Gene Summary Catalyzes the initial step in the synthesis of dolichol-P-P-oligosaccharides. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations