AHA1 (AHSA1) (NM_012111) Human Tagged ORF Clone

CAT#: RG201782

Reviews ()
Write a review
  • TrueORF®

AHSA1 (GFP-tagged) - Human AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1)



  "NM_012111" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AHA1 (AHSA1) (NM_012111) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AHSA1
Synonyms AHA1; C14orf3; hAha1; p38
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG201782 representing NM_012111
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGTGGGGTGAGGGAGACCCACGCTGGATCGTGGAGGAGCGGGCGGACGCCACCAACGTCAACA
ACTGGCACTGGACGGAGAGAGATGCTTCAAATTGGTCCACGGATAAGCTGAAAACACTGTTCCTGGCAGT
GCAGGTTCAAAATGAAGAAGGCAAGTGTGAGGTGACGGAAGTGAGTAAGCTTGATGGAGAGGCATCCATT
AACAATCGCAAAGGGAAACTTATCTTCTTTTATGAATGGAGCGTCAAACTAAACTGGACAGGTACTTCTA
AGTCAGGAGTACAATACAAAGGACATGTGGAGATCCCCAATTTGTCTGATGAAAACAGCGTGGATGAAGT
GGAGATTAGTGTGAGCCTTGCCAAAGATGAGCCTGACACAAATCTCGTGGCCTTAATGAAGGAAGAAGGG
GTGAAACTTCTAAGAGAAGCAATGGGAATTTACATCAGCACCCTCAAAACAGAGTTCACCCAGGGCATGA
TCTTACCTACAATGAATGGAGAGTCAGTAGACCCAGTGGGGCAGCCAGCACTGAAAACTGAGGAGCGCAA
GGCTAAGCCTGCTCCTTCAAAAACCCAGGCCAGACCTGTTGGAGTCAAAATCCCCACTTGTAAGATCACT
CTTAAGGAAACCTTCCTGACGTCACCAGAGGAGCTCTATAGAGTGTTTACCACCCAAGAGCTGGTGCAGG
CCTTTACCCATGCTCCTGCAACATTAGAAGCAGACAGAGGTGGAAAGTTCCACATGGTAGATGGCAACGT
CTCTGGGGAATTTACTGATCTGGTCCCTGAGAAACATATTGTGATGAAGTGGAGGTTTAAATCTTGGCCA
GAGGGACACTTTGCCACCATCACCTTGACCTTCATCGACAAGAACGGAGAGACTGAGCTGTGCATGGAAG
GTCGAGGCATCCCTGCTCCTGAGGAAGAGCGGACGCGACAGGGCTGGCAGCGGTACTACTTTGAGGGCAT
TAAACAGACCTTTGGCTATGGCGCACGCTTATTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG201782 representing NM_012111
Red=Cloning site Green=Tags(s)

MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI
NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG
VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT
LKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP
EGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_012111
ORF Size 1014 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012111.1, NP_036243.1
RefSeq Size 1375 bp
RefSeq ORF 1017 bp
Locus ID 10598
Cytogenetics 14q24.3
Domains DUF704
Gene Summary Acts as a co-chaperone of HSP90AA1. Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity. Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:27353360). [UniProtKB/Swiss-Prot Function]

Citations (1)

Other Versions

Other products for "AHSA1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


AHSA1 mouse monoclonal antibody,clone OTI1D2
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools