AHA1(AHSA1) (NM_012111) Human Tagged ORF Clone

CAT#: RG201782

AHSA1 (GFP-tagged) - Human AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AHA1(AHSA1) (NM_012111) Human Tagged ORF Clone
Symbol AHSA1
Synonyms AHA1; C14orf3; p38
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG201782 representing NM_012111
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGTGGGGTGAGGGAGACCCACGCTGGATCGTGGAGGAGCGGGCGGACGCCACCAACGTCAACA
ACTGGCACTGGACGGAGAGAGATGCTTCAAATTGGTCCACGGATAAGCTGAAAACACTGTTCCTGGCAGT
GCAGGTTCAAAATGAAGAAGGCAAGTGTGAGGTGACGGAAGTGAGTAAGCTTGATGGAGAGGCATCCATT
AACAATCGCAAAGGGAAACTTATCTTCTTTTATGAATGGAGCGTCAAACTAAACTGGACAGGTACTTCTA
AGTCAGGAGTACAATACAAAGGACATGTGGAGATCCCCAATTTGTCTGATGAAAACAGCGTGGATGAAGT
GGAGATTAGTGTGAGCCTTGCCAAAGATGAGCCTGACACAAATCTCGTGGCCTTAATGAAGGAAGAAGGG
GTGAAACTTCTAAGAGAAGCAATGGGAATTTACATCAGCACCCTCAAAACAGAGTTCACCCAGGGCATGA
TCTTACCTACAATGAATGGAGAGTCAGTAGACCCAGTGGGGCAGCCAGCACTGAAAACTGAGGAGCGCAA
GGCTAAGCCTGCTCCTTCAAAAACCCAGGCCAGACCTGTTGGAGTCAAAATCCCCACTTGTAAGATCACT
CTTAAGGAAACCTTCCTGACGTCACCAGAGGAGCTCTATAGAGTGTTTACCACCCAAGAGCTGGTGCAGG
CCTTTACCCATGCTCCTGCAACATTAGAAGCAGACAGAGGTGGAAAGTTCCACATGGTAGATGGCAACGT
CTCTGGGGAATTTACTGATCTGGTCCCTGAGAAACATATTGTGATGAAGTGGAGGTTTAAATCTTGGCCA
GAGGGACACTTTGCCACCATCACCTTGACCTTCATCGACAAGAACGGAGAGACTGAGCTGTGCATGGAAG
GTCGAGGCATCCCTGCTCCTGAGGAAGAGCGGACGCGACAGGGCTGGCAGCGGTACTACTTTGAGGGCAT
TAAACAGACCTTTGGCTATGGCGCACGCTTATTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201782 representing NM_012111
Red=Cloning site Green=Tags(s)

MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI
NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG
VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT
LKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP
EGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_012111
ORF Size 1014 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012111.1, NP_036243
RefSeq Size 1375
RefSeq ORF 1017
Locus ID 10598
Cytogenetics 14q24.3
Domains DUF704
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations