SAP62 (SF3A2) (NM_007165) Human Tagged ORF Clone

CAT#: RG201244

Reviews ()
Write a review
  • TrueORF®

SF3A2 (GFP-tagged) - Human splicing factor 3a, subunit 2, 66kDa (SF3A2)

  View "NM_007165" in other vectors (6)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 650.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name SAP62 (SF3A2) (NM_007165) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SF3A2
Synonyms PRP11; PRPF11; SAP62; SF3a66
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG201244 representing NM_007165
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTTCCAGCATCGCCCCGGGGGCAAGACCGGGAGCGGGGGCGTGGCCTCCTCCTCCGAGAGCAACC
GTGACCGCAGGGAGCGCCTCCGGCAGCTGGCCCTGGAGACCATCGACATCAACAAGGACCCGTACTTCAT
GAAGAACCACCTGGGCTCCTATGAATGCAAACTCTGCCTGACACTTCACAACAATGAGGGGAGCTACCTG
GCACATACGCAGGGGAAGAAGCACCAGACCAACCTGGCCCGGCGAGCAGCCAAGGAGGCCAAGGAGGCCC
CTGCCCAGCCCGCGCCTGAGAAGGTCAAGGTGGAGGTGAAGAAGTTTGTGAAGATCGGCCGCCCGGGCTA
CAAAGTGACCAAGCAGAGAGACTCGGAGATGGGCCAGCAGAGCCTCCTCTTCCAGATTGACTACCCTGAG
ATCGCCGAGGGCATCATGCCACGTCACCGCTTCATGTCTGCGTACGAGCAGAGGATCGAGCCTCCGGACC
GGCGCTGGCAGTACCTGCTCATGGCCGCCGAGCCCTACGAGACCATTGCCTTCAAGGTGCCGAGCAGAGA
GATCGACAAGGCGGAGGGCAAGTTCTGGACACACTGGAACCGGGAGACCAAGCAGTTCTTCCTCCAGTTC
CACTTTAAGATGGAGAAGCCCCCGGCTCCACCCAGCCTCCCTGCTGGCCCCCCTGGGGTGAAGCGGCCTC
CACCCCCGCTGATGAACGGTCTGCCCCCTCGGCCACCGCTGCCTGAGTCTTTGCCACCGCCCCCGCCAGG
AGGCCTGCCTCTGCCACCCATGCCCCCCACAGGGCCTGCGCCCTCAGGGCCCCCGGGACCACCCCAGCTA
CCCCCGCCAGCTCCAGGGGTCCACCCCCCGGCCCCAGTGGTGCATCCCCCTGCATCTGGGGTCCATCCCC
CAGCTCCTGGCGTCCACCCCCCAGCTCCTGGCGTCCATCCCCCAGCCCCTGGGGTCCACCCACCAACCTC
TGGGGTCCACCCCCCAGCTCCTGGAGTCCACCCTCCAGCCCCCGGGGTTCACCCACCAGCCCCCGGAGTC
CACCCACCAGCCCCTGGGGTTCACCCACCAGCCCCAGGGGTCCATCCTCCCCCATCAGCGGGGGTTCACC
CCCAGGCCCCGGGGGTGCACCCAGCAGCCCCCGCCGTTCACCCTCAGGCCCCAGGGGTGCACCCACCAGC
CCCAGGGATGCACCCTCAGGCCCCGGGGGTCCACCCCCAACCTCCCGGGGTCCATCCGTCGGCTCCTGGG
GTCCACCCTCAGCCTCCGGGAGTTCACCCCTCAAATCCTGGGGTGCACCCCCCAACTCCCATGCCCCCAA
TGCTGAGGCCCCCACTTCCCTCCGAAGGCCCAGGGAACATACCTCCCCCTCCCCCAACCAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG201244 representing NM_007165
Red=Cloning site Green=Tags(s)

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYL
AHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPE
IAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF
HFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQL
PPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGV
HPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007165
ORF Size 1392 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007165.4, NP_009096.2
RefSeq Size 1678
RefSeq ORF 1395
Locus ID 8175
Cytogenetics 19p13.3
Domains ZnF_U1
Protein Pathways Spliceosome
Gene Summary This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "SF3A2"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones