Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Tagged ORF Clone

CAT#: RG201211

SUPT4H1 (tGFP-tagged) - Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1)

Product Images

Circular map for RG201211

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Suppressor of Ty 4 homolog 1
• Synonyms: SPT4; SPT4H; Supt4a; SUPT4H
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG201211 representing NM_003168
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCCTGGAGACGGTGCCGAAGGACCTGCGGCATCTGCGGGCCTGTTTGCTGTGTTCGCTGGTCAAGA
  CTATAGACCAGTTTGAATATGATGGTTGTGACAATTGTGATGCATATCTACAAATGAAGGGTAACCGAGA
  GATGGTATATGACTGCACTAGCTCTTCCTTTGATGGAATCATTGCGATGATGAGTCCAGAGGACAGCTGG
  GTCTCCAAGTGGCAGCGAGTCAGTAACTTTAAGCCAGGTGTATATGCGGTGTCAGTCACTGGTCGCCTGC
  CCCAAGGAATCGTGCGGGAGCTGAAAAGTCGAGGAGTGGCCTACAAATCCAGAGACACAGCTATAAAGAC
  C
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG201211 representing NM_003168
  Red=Cloning site Green=Tags(s)
  
  MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW
  VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003168
• ORF Size: 351 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003168.3
• RefSeq Size: 1499 bp
• RefSeq ORF: 354 bp
• Locus ID: 6827
• UniProt ID: P63272
• Cytogenetics: 17q22
• Protein Families: Transcription Factors
• Gene Summary: This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]