PSMA7 (NM_002792) Human Tagged ORF Clone

CAT#: RG201169

PSMA7 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7)

Product Images

Circular map for RG201169

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: PSMA7
• Synonyms: C6; HEL-S-276; HSPC; RC6-1; XAPC7
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG201169 representing NM_002792
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCTACGACCGCGCCATCACCGTCTTCTCGCCCGACGGCCACCTCTTCCAAGTGGAGTACGCGCAGG
  AGGCCGTCAAGAAGGGCTCGACCGCGGTTGGTGTTCGAGGAAGAGACATTGTTGTTCTTGGTGTGGAGAA
  GAAGTCAGTGGCCAAACTGCAGGATGAAAGAACAGTGCGGAAGATCTGTGCTTTGGATGACAACGTCTGC
  ATGGCCTTTGCAGGCCTCACCGCCGATGCAAGGATAGTCATCAACAGGGCCCGGGTGGAGTGCCAGAGCC
  ACCGGCTGACTGTGGAGGACCCGGTCACTGTGGAGTACATCACCCGCTACATCGCCAGTCTGAAGCAGCG
  TTATACGCAGAGCAATGGGCGCAGGCCGTTTGGCATCTCTGCCCTCATCGTGGGTTTCGACTTTGATGGC
  ACTCCTAGGCTCTATCAGACTGACCCCTCGGGCACATACCATGCCTGGAAGGCCAATGCCATAGGCCGGG
  GTGCCAAGTCAGTGCGTGAGTTCCTGGAGAAGAACTATACTGACGAAGCCATTGAAACAGATGATCTGAC
  CATTAAGCTGGTGATCAAGGCACTCCTGGAAGTGGTTCAGTCAGGTGGCAAAAACATTGAACTTGCTGTC
  ATGAGGCGAGATCAATCCCTCAAGATTTTAAATCCTGAAGAAATTGAGAAGTATGTTGCTGAAATTGAAA
  AAGAAAAAGAAGAAAACGAAAAGAAGAAACAAAAGAAAGCATCA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG201169 representing NM_002792
  Red=Cloning site Green=Tags(s)
  
  MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC
  MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG
  TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV
  MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002792
• ORF Size: 744 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002792.2, NP_002783.1
• RefSeq Size: 984 bp
• RefSeq ORF: 747 bp
• Locus ID: 5688
• UniProt ID: O14818
• Cytogenetics: 20q13.33
• Domains: proteasome
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome
• Gene Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012]