EFHD1 (NM_025202) Human Tagged ORF Clone

CAT#: RG200956

  • TrueORF®

EFHD1 (tGFP-tagged) - Human EF-hand domain family, member D1 (EFHD1), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_025202" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
EFHD1 mouse monoclonal antibody,clone OTI8F3
    • 100 ul

USD 447.00


pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "EFHD1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol EFHD1
Synonyms MST133; MSTP133; PP3051; SWS2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200956 representing NM_025202
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGTGAGGAGCTGGCGTGCAAGCTGGAGCGCCGGCTGCGGCGCGAGGAGGCCGAGGAGAGTGGCC
CCCAGCTGGCTCCCCTCGGCGCCCCAGCCCCGGAGCCCAAGCCCGAGCCCGAGCCTCCCGCCCGTGCGCC
CACGGCCAGCGCCGACGCGGAGCTGAGCGCCCAGCTGAGCCGGCGGCTGGACATCAACGAGGGCGCTGCG
CGGCCCCGGCGCTGCAGGGTCTTCAACCCCTACACGGAGTTCCCGGAGTTCAGCCGCCGCCTCATCAAGG
ACCTGGAGAGCATGTTCAAACTGTATGACGCTGGGCGGGATGGCTTCATCGACCTGATGGAGCTGAAGCT
GATGATGGAGAAGCTGGGGGCCCCCCAGACCCACCTGGGCCTGAAGAGCATGATCAAGGAGGTGGATGAG
GACTTCGATGGCAAGCTCAGCTTCCGGGAGTTCCTGCTCATTTTCCACAAGGCCGCGGCAGGGGAGCTGC
AGGAGGACAGTGGGCTGATGGCGCTGGCAAAGCTTTCTGAGATCGATGTGGCCCTGGAGGGTGTCAAAGG
TGCCAAGAACTTCTTTGAAGCCAAGGTCCAAGCCTTGTCATCGGCCAGTAAGTTTGAAGCAGAGTTGAAA
GCTGAGCAAGATGAGCGGAAGCGGGAGGAGGAGGAGAGGCGGCTCCGCCAGGCAGCCTTCCAGAAACTCA
AGGCCAACTTCAATACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200956 representing NM_025202
Red=Cloning site Green=Tags(s)

MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA
RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE
DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK
AEQDERKREEEERRLRQAAFQKLKANFNT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025202
ORF Size 717 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025202.4
RefSeq Size 1889 bp
RefSeq ORF 720 bp
Locus ID 80303
UniProt ID Q9BUP0
Cytogenetics 2q37.1
Domains EFh
Gene Summary This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.