ABHD6 (NM_020676) Human Tagged ORF Clone

CAT#: RG200915

Reviews ()
Write a review
  • TrueORF®

ABHD6 (GFP-tagged) - Human abhydrolase domain containing 6 (ABHD6)



  "NM_020676" in other vectors (4)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ABHD6 (NM_020676) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ABHD6
Synonyms abhydrolase domain containing 6; lipase protein
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG200915 representing NM_020676
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTTGATGTGGTTAACATGTTTGTGATTGCGGGCGGCACGCTGGCCATCCCAATCCTGGCATTTG
TGGCTTCATTTCTTCTGTGGCCTTCAGCACTGATAAGAATCTATTATTGGTACTGGCGGAGGACATTGGG
CATGCAAGTCCGCTATGTTCACCATGAAGACTATCAGTTCTGTTATTCCTTCCGGGGCAGGCCTGGGCAC
AAACCCTCCATCCTCATGCTCCACGGATTCTCTGCCCACAAGGATATGTGGCTCAGTGTGGTCAAGTTCC
TTCCAAAGAACCTGCACTTGGTCTGCGTGGACATGCCAGGACATGAGGGCACCACCCGCTCCTCCCTGGA
TGACCTGTCCATAGATGGGCAAGTTAAGAGGATACACCAGTTTGTAGAATGCCTGAAGCTGAACAAAAAA
CCTTTCCACCTGGTAGGCACCTCCATGGGTGGCCAGGTGGCTGGGGTGTATGCTGCTTACTACCCATCGG
ATGTCTCCAGCCTGTGTCTCGTGTGTCCTGCTGGCCTGCAGTACTCAACTGACAATCAATTTGTACAACG
GCTCAAAGAACTGCAGGGCTCTGCCGCCGTGGAGAAGATTCCCTTGATCCCGTCTACCCCAGAAGAGATG
AGTGAAATGCTTCAGCTCTGCTCCTATGTCCGCTTCAAGGTGCCCCAGCAGATCCTGCAAGGCCTTGTCG
ATGTCCGCATCCCTCATAACAACTTCTACCGAAAGTTGTTTTTGGAAATCGTCAGTGAGAAGTCCAGATA
CTCTCTCCATCAGAACATGGACAAGATCAAGGTTCCGACGCAGATCATCTGGGGGAAACAAGACCAGGTG
CTGGATGTGTCTGGGGCAGACATGTTGGCCAAGTCAATTGCCAACTGCCAGGTGGAGCTTCTGGAAAACT
GTGGGCACTCAGTAGTGATGGAAAGACCCAGGAAGACAGCCAAGCTCATAATCGACTTTTTAGCTTCTGT
GCACAACACAGACAACAACAAGAAGCTGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200915 representing NM_020676
Red=Cloning site Green=Tags(s)

MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGH
KPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKK
PFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEM
SEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQV
LDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020676
ORF Size 1011 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020676.4, NP_065727.3
RefSeq Size 2364 bp
RefSeq ORF 1014 bp
Locus ID 57406
Cytogenetics 3p14.3
Domains abhydrolase
Protein Families Transmembrane

Citations (1)

Other Versions

Other products for "ABHD6"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit anti-ABHD6 polyclonal antibody
    • 100 ul

USD 205.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools