HSCB (NM_172002) Human Tagged ORF Clone

CAT#: RG200843

Reviews ()
Write a review
  • TrueORF®

HSCB (GFP-tagged) - Human HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 500.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol HSCB
Synonyms DNAJC20; HSC20; JAC1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200843 representing NM_172002
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCGGGGGAGAGCCGGGGCTTTGCTCCGGGTGTGGGGGTTTTGGCCGACAGGGGTTCCCAGAAGGA
GACCGCTAAGCTGCGATGCTGCGTCGCAGGCGGGAAGCAATTATCCCCGCTGTTGGAACTGCGGCGGCCC
ATGGGGCCCCGGGCGGGAGGACAGGTTCTTCTGCCCACAGTGCCGAGCGCTGCAGGCACCTGACCCCACT
CGAGACTACTTCAGCCTTATGGACTGCAACCGTTCCTTCAGAGTTGATACAGCGAAGCTCCAGCACAGGT
ACCAGCAACTGCAGCGTCTTGTCCACCCAGATTTCTTCAGCCAGAGGTCTCAGACTGAAAAGGACTTCTC
AGAGAAGCATTCGACCCTGGTGAATGATGCCTATAAGACCCTCCTGGCCCCCCTGAGCAGAGGACTGTAC
CTTCTAAAGCTCCATGGAATAGAGATTCCTGAAAGGACAGATTATGAAATGGACAGGCAATTCCTCATAG
AAATAATGGAAATCAATGAAAAACTCGCAGAAGCTGAAAGTGAAGCTGCCATGAAAGAGATTGAATCCAT
TGTCAAAGCTAAACAGAAAGAATTTACTGACAATGTGAGCAGTGCTTTTGAACAAGATGACTTTGAAGAA
GCCAAGGAAATTTTGACAAAGATGAGATACTTTTCAAATATAGAAGAAAAGATCAAGTTAAAGAAGATTC
CCCTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200843 representing NM_172002
Red=Cloning site Green=Tags(s)

MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT
RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY
LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE
AKEILTKMRYFSNIEEKIKLKKIPL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_172002
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_172002.5
RefSeq Size 1106 bp
RefSeq ORF 708 bp
Locus ID 150274
UniProt ID Q8IWL3
Cytogenetics 22q12.1
Gene Summary This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Other products for "HSCB"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.