Lipoamide Dehydrogenase(DLD) (NM_000108) Human Tagged ORF Clone

CAT#: RG200639

DLD (GFP-tagged) - Human dihydrolipoamide dehydrogenase (DLD)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Lipoamide Dehydrogenase(DLD) (NM_000108) Human Tagged ORF Clone
Symbol DLD
Synonyms DLDD; DLDH; E3; GCSL; LAD; PHE3
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG200639 representing NM_000108
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAGCTGGAGTCGTGTGTACTGCTCCTTGGCCAAGAGAGGCCATTTCAATCGAATATCTCATGGCC
TACAGGGACTTTCTGCAGTGCCTCTGAGAACTTACGCAGATCAGCCGATTGATGCTGATGTAACAGTTAT
AGGTTCTGGTCCTGGAGGATATGTTGCTGCTATTAAAGCTGCCCAGTTAGGCTTCAAGACAGTCTGCATT
GAGAAAAATGAAACACTTGGTGGAACATGCTTGAATGTTGGTTGTATTCCTTCTAAGGCTTTATTGAACA
ACTCTCATTATTACCATATGGCCCATGGAAAAGATTTTGCATCTAGAGGAATTGAAATGTCCGAAGTTCG
CTTGAATTTAGACAAGATGATGGAGCAGAAGAGTACTGCAGTAAAAGCTTTAACAGGTGGAATTGCCCAC
TTATTCAAACAGAATAAGGTTGTTCATGTCAATGGATATGGAAAGATAACTGGCAAAAATCAAGTCACTG
CTACGAAAGCTGATGGCGGCACTCAGGTTATTGATACAAAGAACATTCTTATAGCCACGGGTTCAGAAGT
TACTCCTTTTCCTGGAATCACGATAGATGAAGATACAATAGTGTCATCTACAGGTGCTTTATCTTTAAAA
AAAGTTCCAGAAAAGATGGTTGTTATTGGTGCAGGAGTAATAGGTGTAGAATTGGGTTCAGTTTGGCAAA
GACTTGGTGCAGATGTGACAGCAGTTGAATTTTTAGGTCATGTAGGTGGAGTTGGAATTGATATGGAGAT
ATCTAAAAACTTTCAACGCATCCTTCAAAAACAGGGGTTTAAATTTAAATTGAATACAAAGGTTACTGGT
GCTACCAAGAAGTCAGATGGAAAAATTGATGTTTCTATTGAAGCTGCTTCTGGTGGTAAAGCTGAAGTTA
TCACTTGTGATGTACTCTTGGTTTGCATTGGCCGACGACCCTTTACTAAGAATTTGGGACTAGAAGAGCT
GGGAATTGAACTAGATCCCAGAGGTAGAATTCCAGTCAATACCAGATTTCAAACTAAAATTCCAAATATC
TATGCCATTGGTGATGTAGTTGCTGGTCCAATGCTGGCTCACAAAGCAGAGGATGAAGGCATTATCTGTG
TTGAAGGAATGGCTGGTGGTGCTGTGCACATTGACTACAATTGTGTGCCATCAGTGATTTACACACACCC
TGAAGTTGCTTGGGTTGGCAAATCAGAAGAGCAGTTGAAAGAAGAGGGTATTGAGTACAAAGTTGGGAAA
TTCCCATTTGCTGCTAACAGCAGAGCTAAGACAAATGCTGACACAGATGGCATGGTGAAGATCCTTGGGC
AGAAATCGACAGACAGAGTACTGGGAGCACATATTCTTGGACCAGGTGCTGGAGAAATGGTAAATGAAGC
TGCTCTTGCTTTGGAATATGGAGCATCCTGTGAAGATATAGCTAGAGTCTGTCATGCACATCCGACCTTA
TCAGAAGCTTTTAGAGAAGCAAATCTTGCTGCGTCATTTGGCAAATCAATCAACTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200639 representing NM_000108
Red=Cloning site Green=Tags(s)

MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCI
EKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAH
LFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLK
KVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTG
ATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNI
YAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTL
SEAFREANLAASFGKSINF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000108
ORF Size 1527 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000108.3, NP_000099
RefSeq Size 3579
RefSeq ORF 1530
Locus ID 1738
Cytogenetics 7q31.1
Domains pyr_redox, pyr_redox_dim
Protein Families Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Citrate cycle (TCA cycle), Glycine, serine and threonine metabolism, Valine, leucine and isoleucine degradation, Pyruvate metabolism, Metabolic pathways
Gene Summary This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In homodimeric form, the encoded protein functions as a dehydrogenase and is found in several multi-enzyme complexes that regulate energy metabolism. However, as a monomer, this protein can function as a protease. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations